KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0211Help
Entry
HMPREF9228_0211   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3357 DUF4307 DUF1510 DUF2207 TrbC Wzy_C_2 DUF2417 Synaptobrevin GET2 RskA
Motif
Other DBs
NCBI-ProteinID: AEF27875
Position
complement(261932..262429)
Genome map
AA seq 165 aa AA seqDB search
MTDAQQANGNQSESQNQAEATAQPHNKRVTKWVAIVIAIVAVAIIAAVAVFGTRAYSASQ
YDSAVAACAAASEDVRNATNDYNNLVNGDAAEAAALTKADVSDASALDALSKELTVELPT
YEGCVADDTKGYQAATKKLEQQVTWYHEHTTSLQKAVDAVNAVKK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcacagcaggcgaacggcaaccagtccgaatcccagaaccaagcagaagcg
acggcacagccgcacaacaagcgagtgacgaagtgggtcgctatagtgattgccatcgtg
gcggtggcgattatcgccgcggtcgcggtgttcggcacccgcgcatacagcgcgtctcag
tacgatagcgcagtggccgcctgcgccgccgcctcggaagacgtacgtaacgccaccaac
gactacaacaacttggtcaatggcgatgctgcagaagccgccgctctgaccaaggcagac
gtctcggacgcctccgctctcgacgcgctgtccaaggaactgaccgtggaactgccgacg
tacgaaggctgcgtggccgacgacaccaagggctaccaggccgcgaccaagaaactcgaa
cagcaggtcacgtggtaccacgagcacaccacgtcgctgcagaaggctgttgacgccgtc
aacgcggtcaagaagtaa

DBGET integrated database retrieval system