KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0214Help
Entry
HMPREF9228_0214   CDS       T01844                                 

Definition
(GenBank) transcriptional regulator, HxlR family
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR PadR MarR_2
Motif
Other DBs
NCBI-ProteinID: AEF27682
Position
complement(263776..264135)
Genome map
AA seq 119 aa AA seqDB search
MIPTITRGDAMIDVDTLPACPVETTLTLISDKWKILIVRDLLTGTKRFSELRRSIGHISQ
KVLTSNLRQMEADGLVHREVYPEVPPRVEYSLTDTGHSLKTVIDALWNWGEDYKAKLAA
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgattccaacgattacacgaggtgatgctatgatcgatgtcgacacgctcccggcgtgt
cccgtggagacgacgctcacactgatttccgacaaatggaaaattctcatcgtgcgcgac
ctgctgaccggcaccaagcgcttcagcgaactacgtcgctcaatcgggcacatctcacag
aaggtgctcacctcgaacctgcgacagatggaagccgacggacttgtgcatcgcgaggtt
taccccgaagtgccgccgcgcgtcgaatactctctgaccgacactggccatagcctcaaa
accgtcatcgacgctctatggaattggggagaagactacaaggccaagctcgccgcctga

DBGET integrated database retrieval system