KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0215Help
Entry
HMPREF9228_0215   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
  KO
K07118  uncharacterized protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    HMPREF9228_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 NmrA E3_UbLigase_EDD
Motif
Other DBs
NCBI-ProteinID: AEF26391
Position
264303..264764
Genome map
AA seq 153 aa AA seqDB search
MTQNIAVIAANGKSGQLIVREAVDRGLDVTAVVRGENKTVTQHAIIKDLFDLTAADLAGF
DVVVDAFGAWTPETFPQHSTSLKHLADVLSGADARLIVVGGAGSLYVNPEHTVQLSQTDG
FPETFLPLATAMGLRIIAWGGAALKPFASTLSS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaacatcgcagttatcgcagccaacggcaagtccggccagctcattgtcagg
gaggccgttgatcgcggacttgacgtgactgctgttgtgcgcggggagaacaaaaccgtc
acccagcacgccatcatcaaggatctgttcgacctgaccgcagcagatctcgccggattc
gatgtggtcgtcgacgcgttcggcgcatggacgccggaaaccttcccccagcactccacg
tcgttgaagcatctcgcggacgtcctctccggtgctgacgcgcgactgatcgtggttgga
ggtgccggtagcctgtacgtcaacccggagcataccgtgcagctgagccaaaccgatggc
ttcccggagacgttcctcccgctcgccaccgcgatggggcttcgcatcattgcctggggc
ggggctgcgctcaagccgtttgcttcgacgctgtcgtcgtag

DBGET integrated database retrieval system