KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0224Help
Entry
HMPREF9228_0224   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
  KO
K07454  putative restriction endonuclease
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    HMPREF9228_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HNH_2
Motif
Other DBs
NCBI-ProteinID: AEF26572
Position
complement(280906..281694)
Genome map
AA seq 262 aa AA seqDB search
MAFALYIVLKPRECDDKGLDVQRLASFLHRTPSSVVLKIWNIAAYDANRKARGRVGMKHG
SKLDSQVWQWYAEDPDTFMEQCLNLLRHALLQADANNFNPAPLASDRYSPLETATTLLVA
EHTPTGEERPITTLQRVNQSYFRNSLLQNYHSTCCITGMQIPKLLIASHIKPWKASSAVE
KTAASNGLLLNAFHDRAFDQGLISIDDDYRIMVNHDKVRHSDINDKWLYNFEGREISLPT
ISQPSHEFIEYHHKHIFLADAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgccttgtacatcgtgcttaaaccacgcgaatgcgatgacaaaggacttgac
gtgcaacgtctcgcatcgttcttgcaccgcactcccagctcagtggtgttgaagatctgg
aacatcgcagcttatgatgccaaccgcaaggcccgtgggcgcgtaggcatgaagcacggc
agcaaactcgactcccaagtctggcagtggtatgccgaagaccccgatacgttcatggag
caatgtctgaatctacttcggcacgcactcctgcaagcggacgcgaacaacttcaaccca
gcaccgctggcctccgaccgttattcccctctcgaaaccgcaacgaccctactcgttgcc
gaacacacgcccaccggagaggaacgaccaataacaacacttcagcgagtcaaccaatcc
tatttccgcaactcactattgcagaactaccacagcacctgctgtataaccggtatgcag
attcctaagctgctgatcgccagccacatcaaaccgtggaaggcatcgtcagccgttgag
aaaaccgccgcatccaacgggctgctgctcaacgccttccacgaccgtgccttcgatcag
ggccttatctccatcgatgatgactatcgcatcatggtcaatcatgacaaggttcggcac
tctgacatcaacgacaaatggctctacaacttcgaaggacgcgaaatctcattaccgaca
atcagccaaccttcacacgaattcatcgaataccaccacaagcacatcttcctcgccgac
gccgcttaa

DBGET integrated database retrieval system