KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0227Help
Entry
HMPREF9228_0227   CDS       T01844                                 

Gene name
dcm
Definition
(GenBank) DNA (cytosine-5-)-methyltransferase
  KO
K00558  DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00270  Cysteine and methionine metabolism
bbv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HMPREF9228_0227 (dcm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bbv03032]
    HMPREF9228_0227 (dcm)
   03036 Chromosome and associated proteins [BR:bbv03036]
    HMPREF9228_0227 (dcm)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:bbv02048]
    HMPREF9228_0227 (dcm)
Enzymes [BR:bbv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     HMPREF9228_0227 (dcm)
DNA replication proteins [BR:bbv03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    HMPREF9228_0227 (dcm)
Chromosome and associated proteins [BR:bbv03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    HMPREF9228_0227 (dcm)
Prokaryotic defense system [BR:bbv02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    HMPREF9228_0227 (dcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_methylase
Motif
Other DBs
NCBI-ProteinID: AEF26616
Position
complement(284683..285861)
Genome map
AA seq 392 aa AA seqDB search
MDDNRTHAATNTARPQALEFFAGIGLARLGLEEAGFQVEWSNDIDAAKCEMYRNNFTDTP
GHTLVEGDMSELSGDDLPHDASIAWGSSPCTDLSLAGTRTGLNGKQSGAFWQYVRLLEEL
GNTRPPIAVLENVNGLATSHSGEDLAAAVHAFNELGYSVDVLSIDTRRFIPQSRPRLFLV
GLQNPPAAEQFDSSLRPDWLQQVFADTSLRTHRAPLPEPPSPLMSGLNMYVESMANDDER
WWNAERTAKFLDSLSPVQATRVETLRNGATDSYRTAYRRTRNGKAVWEVRADDISGCLRT
ARGGSSRQAIIRMGNGKTAVRWMTPREYAALMGAAHYNITGLRPNQVMFGFGDAVSVPVV
EWLGKHYFMPALNGTLGKDLYVEQTLLSNHTA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggacgataatcgcacgcacgcggctaccaacacagcacgcccgcaagccctcgaattc
tttgcaggaataggcctagcacgccttggactcgaagaagccggcttccaggtcgaatgg
tcgaacgacatcgacgccgccaagtgcgaaatgtatcgcaataacttcacggatacgccg
ggccacacccttgtcgagggggatatgagtgagctctccggcgacgatctgccccacgat
gcctccatcgcttggggatcctccccttgcacggacctctcccttgcaggcactcgtacg
ggcctgaacggcaagcaatccggcgctttctggcaatacgtgcgactgctcgaagaactt
gggaacacccggccgccgattgccgttctcgagaatgtgaacggattggccacttctcac
tctggggaagaccttgccgcagcagtgcatgccttcaatgaactgggctactccgtagac
gtattgtccatcgacactcgtcgatttatccctcagtcccgaccgcgactctttttagtg
ggcctgcagaatccgccggccgccgaacagtttgattcttccctgcgccctgactggctg
cagcaggtctttgcggacacctctctccgcacgcatcgcgcaccactgcccgaaccgccg
tcccccctgatgtctggcctcaatatgtacgtcgagagcatggctaacgacgacgaacgc
tggtggaacgctgagagaactgccaaattccttgattcgctgtcgccggttcaggcaact
cgtgtagaaacgttgcgcaatggggcaaccgattcctaccggactgcttatcgccgcacc
cgcaacggcaaagccgtgtgggaagtccgcgcagacgacatctccggctgcctacgcacc
gcacgaggcggctcttctcgccaagcgatcattcgcatgggcaatggcaaaaccgctgtc
cgttggatgacaccacgcgaatacgctgctcttatgggcgcagcccactacaacattacg
ggtctacgccccaatcaagtgatgttcggattcggcgacgccgtctccgtccccgtcgtg
gaatggcttggcaagcactacttcatgcctgcactgaacggcaccctaggcaaagaccta
tacgtggagcaaactctgctctcaaatcacactgcataa

DBGET integrated database retrieval system