KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0231Help
Entry
HMPREF9228_0231   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17
Motif
Other DBs
NCBI-ProteinID: AEF27906
Position
complement(290334..290528)
Genome map
AA seq 64 aa AA seqDB search
MAAIPTKNDYPRLTAKPAQVAEMLGYKDVKSVYGLIRTGKIRARKVGNTFLVNLTSVREF
AGEE
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaattccaacgaagaacgactatccgcgtctcaccgccaagccagcgcaagtg
gcagagatgctgggatacaaggacgtgaaaagtgtctacgggttaatcagaaccggaaag
attcgcgcccgcaaggtaggtaacacgtttctggtgaatctcaccagcgtgcgcgaattc
gcaggtgaggagtga

DBGET integrated database retrieval system