KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0812Help
Entry
HMPREF9228_0812   CDS       T01844                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00260  Glycine, serine and threonine metabolism
bbv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbv01100  Metabolic pathways
bbv01110  Biosynthesis of secondary metabolites
bbv01130  Biosynthesis of antibiotics
bbv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9228_0812 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF9228_0812 (trpB)
Enzymes [BR:bbv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF9228_0812 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PALP QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEF26980
Position
950099..952186
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQQTRELTVSLEDVKKAALAAPAPINATRWLKRADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYEKGGASAISVLTEGRKFLGSLDDFDKVRAAVHIPVLRKDFI
VTDYQIYEARAHGADLVLLIVAALDDAQLKHLLDLAHELSMTVLVETHTREEIERACQAG
AKVIGINARNLKNLKVDVNKYNELAADLPDDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADDHELAVERLVKAGAQVKASETTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYTQAKADPEFHKEFMTLQQRYVGRPSPLTEAPRFAALVKEKTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDDRVNLYGYEAGGNGPE
SGQHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDEEAMNAFRDLSQSEGIIPAIESSHAVAGAYKAAADLKAKGYNKAVMIVNISG
RGDKDMATAGKWFGYLTDDQAAALDVAGTHGDTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggatgaattggtggcgggcgcactggaggaccagcaaacccgcgagctc
accgtgtctcttgaggatgtgaagaaggccgcgctggcggccccggctccgattaacgca
acacgatggctcaagcgcgccgatggcatcccggtgatcgccgaaatcaagcgcgcgtcc
ccgtccaagggccacctctccgacatcccggacccggccgcgttggcccgcgagtacgag
aagggcggcgcaagcgccatttccgtgctcactgaaggtcgcaaattcctcggcagcctt
gatgatttcgacaaggtccgcgccgccgtgcatattccggtgctgcgcaaggacttcatc
gtcaccgactaccagatctacgaagcccgcgcccacggtgccgatttggtgctgctcatc
gtcgccgcattggacgacgcccagctcaaacatctgctggatttggcgcacgagttgagc
atgaccgtgctggtcgaaacgcacacccgcgaggagatcgaacgcgcatgtcaggccggc
gccaaggtgatcggcatcaacgcgcgcaacctgaagaacctcaaggtggacgtgaacaaa
tacaacgaactcgcggccgatctgcccgatgacgtcatcaaggtggcggaatccggcgta
ttcggcgcggtcgaggtcgaagactacgcccgcgcgggagcggacgcggtactggtcggc
gagggcgtggccaccgccgacgatcatgaacttgcagtggaacgactagtaaaggcagga
gcacaagtgaaagcatccgaaacaaccccgctcagcgaacatcagggaccgtattggggt
cagttcggcggccgctatgtgcccgaggccctcatcaccgccctcgacgagcttgagcgc
gtctacacgcaagccaaagccgaccccgaattccacaaggaattcatgacgctccagcag
cgttacgtgggccgcccgagcccgctgaccgaagccccgcgcttcgccgcactcgtcaag
gagaagaccggcctcgacgcccgtatcttcctcaagcgcgaggatttgaaccacaccggt
gcgcacaagatcaacaacgcgctcggacaggccttgctcgtcaagcgcatgggcaagaca
cgcgtgatcgccgaaaccggtgccggccagcacggcgtggccaccgctaccgtgtgcgcc
atgcttggcctcaagtgccgcatctacatgggccagatcgacgcccgccgccaggccctg
aacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgaccctcggcgacaag
attctgaaggatgccatcaacgaggccctgcgtgactgggtcaccaacgtcaaggacacg
cactacctgctcggcaccgtcgcaggcccgcacccgttcccggccatggtgcgcgacttc
cagaagatcatcggcgaggaagccaagcagcagcttcaggactggtacggcatcgaccat
ccggacgcgatttgcgcttgcgtgggcggcggctccaacgccatcggcgtgatgaacgcc
ttcctggacgatgaccgcgtgaacctctacggctacgaagccggcggcaacggccccgaa
tccggccagcacgccatccgcttcgcccccggcaccggccagctcggcatgttccagggt
gccaagagctacctgctggaaaccgacgaaggccagacgctcgatacctactcgatctct
gcaggccttgactacgcttccgtggggccagagcacgcatggctcaaggacatcggccgc
gtgaactacagctgggccaccgatgaggaggccatgaacgccttccgcgacctaagccag
agcgagggcatcatccccgccatcgaaagctcgcacgccgtggccggcgcgtacaaggcc
gccgcggatctgaaggccaagggctataacaaggccgtgatgatcgtgaacatctccggc
cgaggcgacaaggacatggccaccgccggcaagtggtttggctacctgaccgacgatcag
gccgccgcgctcgatgtggccggcacccacggcgacaccgtcgcctga

DBGET integrated database retrieval system