KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1002Help
Entry
HMPREF9228_1002   CDS       T01844                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HMPREF9228_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PRRSV_2b
Motif
Other DBs
NCBI-ProteinID: AEF27752
Position
complement(1146607..1147659)
Genome map
AA seq 350 aa AA seqDB search
MDVSLANFIQQVFSNPALFVTTLLTLGVIFVNGWTDAPNAIATCVTTRCMRVRSAVIMAA
IFNFLGVFIMTQLNASVASTISNMVDFGGDTNAALIALCAALFSIVVYSVGASLLGIPTS
ESHSLIAGLSGAAIAIQGGIGGINMDEWVKVLYGLVASLLFGFAIGWLVCKVVTLICAGM
DRRRTNGFFTYAQIVGAAAMSFMHGAQDGQKFIGVLFLGMAFCNGQPSVVGVMIPVWLMI
LCSTIMGVGTSVGGERIIKSVGQDMVKLEKYQGFSADLSSALCLLVMTVLGIPVSTTHTK
TSAIMGVGAVRRISAINFGVVRDMMLTWVFTFPGCGLISFVMAKLFMVVF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttggatgtctccctggcgaatttcattcagcaggtgttctcgaacccggctctgttcgtg
acgacattgctgacgttgggggttatcttcgtcaacggctggaccgatgcgcccaatgct
atcgccacttgtgtgaccacgcgatgcatgcgcgtgcgttccgccgtgatcatggcggcc
atctttaacttcctcggcgtcttcatcatgacgcagctcaatgcctccgtggcctccacc
atcagcaatatggtcgatttcggaggtgatacgaatgcggcattgattgccctatgcgcg
gcactgttctccatcgtcgtatacagcgtgggagcctcgttgctgggtattccgacttcg
gaaagccacagtctgatcgccggcctgtccggtgcggccatcgccatccagggcggcatt
ggcggcatcaacatggacgaatgggtcaaggtgctgtacggtctggtggccagccttctg
ttcggattcgccatcggctggctggtgtgcaaggtcgtgacgctgatctgcgctggcatg
gaccgccgccgcaccaacggattctttacgtacgcgcagattgtgggcgcggccgccatg
agcttcatgcacggcgcgcaggacggccagaaattcatcggcgtgctgtttcttggcatg
gcgttctgcaatggtcagcccagtgtggtgggcgtgatgatcccggtctggctgatgatt
ctgtgcagcaccattatgggcgtgggtacgtccgtgggcggcgagcgcatcatcaaatcc
gtgggccaggacatggtcaaactcgagaaataccagggcttctccgccgacctgtcgagc
gcactgtgtctgctcgttatgaccgtgctcggcattcccgtctccaccacgcacaccaag
accagcgccattatgggcgtgggcgcggtacgccgcatttccgccatcaacttcggcgtg
gtgcgcgacatgatgctcacctgggtgttcacgttccccggctgcggtcttatcagcttc
gtaatggccaaactgttcatggtcgtgttctag

DBGET integrated database retrieval system