KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1210Help
Entry
HMPREF9228_1210   CDS       T01844                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00900  Terpenoid backbone biosynthesis
bbv01100  Metabolic pathways
bbv01110  Biosynthesis of secondary metabolites
bbv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF9228_1210 (dxr)
Enzymes [BR:bbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HMPREF9228_1210 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEF26378
Position
complement(1381524..1382714)
Genome map
AA seq 396 aa AA seqDB search
MSVVSNSTVVILGSTGSIGTQGLDVIARHPERFTVTGLAAGGAHIELLARQAAQFRVPEV
AVFDSTKIPALKEALQQAGARDTRVTGGPDAVIALAGSGANVVLNGITGSIGLEPSIAAL
KANSQLALANKESVVAGGHLLFSAQVRDDQINPVDSEHSAIWQSLRSGTHAEVSKLVVTA
SGGPFRGWKRADMANITPEQALHHPTWNMGPVVTINSSTLMNKGLEVIEASRLFDVPPDR
IDVTVHPQSIVHSMVEFVDGATICQASPPDMRLPIALGLSAPDRMDNVAAACDWTQAATW
TFEPLDNEAFPAVQLARHCLGASEKHTAVLNAANEQAVHAFLDHRLPYLGIVDTVKAVLD
QMDAELRGDPLFTDVEEMGQIELEARHRADDLINKQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtagtctccaactccaccgtcgtaattcttggatctaccggatccatcggcaca
caaggccttgatgtcattgcacgccatcctgagcgtttcactgtcacgggtttggccgcc
ggcggcgctcatatcgaattgctggctcgtcaggccgcacaattccgtgtaccggaagtt
gcggtattcgacagcaccaagattccggcactgaaggaggcgctgcaacaggccggtgcc
cgcgacacccgcgtgaccggcggaccggatgccgtgatcgcattggcaggttccggtgcg
aacgtcgtgctgaacggcattaccggttccattggtctcgagccgtccatcgccgcgctg
aaagccaattcacagcttgcactggccaataaggaatcagtggtggccggcggtcatctg
ctgttcagcgcgcaagtgcgcgacgatcagatcaatccggttgactccgaacattccgcc
atctggcagtcgttgcgttccggcacccatgccgaggtctccaagctggtggtcacagcc
tccggtggtccgttccgaggctggaaacgtgctgatatggcgaatatcacgcctgagcag
gcgttgcatcatccgacgtggaacatgggtccggttgtgaccatcaactcctcgaccctg
atgaacaagggactcgaggttattgaggcttcccgactgttcgatgtgccgccggaccgt
attgacgtaacggtgcacccgcaatccattgtccattccatggtcgaattcgtggatggc
gccactatctgccaggcttcaccgccggacatgcgcctgcccatcgcgctcggcttgtcc
gcgcctgaccgcatggacaatgtggctgccgcatgtgactggacgcaggctgcaacctgg
acgttcgagccgctggataatgaggcgttccccgccgtccagctcgcccgccattgtctg
ggtgcatccgaaaagcatacggccgtgctcaacgcggccaatgagcaggccgtgcacgcc
ttcctcgaccatcgtctgccgtaccttggcatcgtggacacggtgaaggccgtgctcgac
cagatggatgccgaactgcgtggcgacccgctgttcacggacgtggaggaaatgggacag
attgagcttgaagctcgtcaccgtgccgatgatttgataaacaaacaatga

DBGET integrated database retrieval system