KEGG   Bdellovibrio bacteriovorus W: BDW_06165Help
Entry
BDW_06165         CDS       T03036                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bbw  Bdellovibrio bacteriovorus W
Pathway
bbw00450  Selenocompound metabolism
bbw00970  Aminoacyl-tRNA biosynthesis
bbw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BDW_06165
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BDW_06165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbw01007]
    BDW_06165
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbw03016]
    BDW_06165
Enzymes [BR:bbw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BDW_06165
Amino acid related enzymes [BR:bbw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BDW_06165
Transfer RNA biogenesis [BR:bbw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BDW_06165
 Prokaryotic type
   Other AARSs
    BDW_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 DUF222 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AHI05739
UniProt: W5WX29
Position
complement(1292180..1294267)
Genome map
AA seq 695 aa AA seqDB search
MSHSTNTNTSPRDILITCALPYANGYIHLGHMVEYLQADFWARFQNMRGNKCLYICADDT
HGTPIMVKARELGITPEQLIANSYTEHTKDFADFQINFSHYGSTNSQENKELCEFFYEKM
VAGNHTRKQLIEQQYCEHDKMFLPDRFVKGTCPKCGAKEQYGDSCDVCGSTYSPIDMKDV
HCVLCGNKPVMKQSESIFFKLNDFKEYLAEWIPKHCAPEVSKKMLEWFDEDLLDLDISRD
EPYFGFPIPGTNGKKFFYVWVDAPMGYISTTQQWARANNKTLEEIWQNPKTEIYHFIGKD
IARFHTIFWPAFLKAAGFRSPDQVFVHGHLMVNGEKMSKSKGTFIAARTYLNHLNPEYLR
YYYATKLNSSVDDIDLNLEDFSSRVNSELVGKITNLGSRGGQMLKKKMDGKMSTPDVDGA
KVLKLAQEKAQVIAEHYEARDFAKALTEIRNLADEANRYFDEKAPWKTLEADPEGTKRVL
TTTLNLFRVLAIYLKPILPIYSEKVAVLLNESDYKWSDAQTVLENVEINNYTHLATRIEA
EKIKDMVEEGRVINERLQAQKAKASTAPAAAATAKESTKTAEVSESGLIDFADFEKVELR
VGQVIEAEEIKEADKLLRLKVDIGNGEIRQIIAGIKAAYTAESLLNRKLLVCVNLKPRKM
KFGMSEGMVLAAGSGGSDLFVLSPDEGAQVGQRVK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattccacaaataccaacacttccccacgcgacatcttgatcacatgtgctctt
ccctacgccaatggttatatccatttaggccacatggtggagtatctgcaagccgacttc
tgggcacgttttcaaaacatgcgtggcaataagtgtttgtacatctgtgcggacgacact
cacggaacaccgatcatggtaaaagctcgtgaactcggcatcacacctgagcagctcatt
gcgaactcttacactgaacacacaaaagactttgcagattttcaaatcaatttttctcac
tatggctctacaaactcgcaagagaacaaagaactgtgcgaattcttctacgagaaaatg
gttgctgggaatcacacgcgcaaacaactcattgagcagcagtattgtgaacacgataaa
atgttccttcctgatcgcttcgtcaaaggcacatgcccgaagtgtggcgctaaagagcaa
tacggcgactcttgtgatgtatgtggatcgacttattcaccgattgatatgaaagacgtg
cattgcgttctttgtggcaataagccagtgatgaaacaaagtgagagtatcttctttaag
ctcaatgactttaaagagtaccttgctgaatggattccgaaacactgtgctcctgaagtt
tctaaaaaaatgcttgagtggttcgatgaagatcttttggatctagatatctctcgagat
gagccttacttcggcttcccgattccaggaactaatgggaaaaagtttttctacgtttgg
gtagatgctccaatgggttatatctccacgactcagcaatgggcccgtgcgaataacaaa
acattagaagagatctggcaaaatccaaagactgagatctatcattttatcggaaaagat
attgcacgcttccacaccatcttttggccggcatttttaaaagctgctggctttagaagt
cctgaccaagtttttgttcatggtcatttgatggtcaatggcgagaaaatgtctaaatca
aaaggtacgttcatcgcagcaagaacttatctaaatcacctcaacccagagtacttgcgc
tattactacgcgacgaaattgaatagctctgtggatgatattgatttaaatcttgaagat
ttctcaagccgtgtgaattcagagcttgtgggtaaaatcacaaatcttggttcgcgtggt
ggacagatgttgaaaaagaaaatggacggcaaaatgtctacacctgatgtagatggcgca
aaggtccttaagcttgctcaagaaaaggcccaagtcattgcggaacattatgaagcacgt
gattttgctaaggctctaacggagatcagaaatcttgccgacgaagctaatagatatttt
gacgaaaaggctccgtggaaaactctggaagcagatcctgaagggactaaacgcgttctt
accacaactttgaatttattcagagtgctggcaatttatttaaaaccgattcttcctatc
tactctgaaaaggtagcggttttattaaatgaaagcgattacaagtggagtgacgctcaa
actgttctagagaatgtagagatcaataactacactcaccttgcaacacgtattgaggct
gaaaaaatcaaagacatggttgaagaaggccgcgttattaacgaaagactgcaagcccaa
aaagccaaagcatcgacagcaccagcggcggctgccactgctaaagagtctacaaaaacg
gcggaagtttctgaatctggcttaattgattttgctgactttgaaaaagtcgaactgcgt
gtaggtcaagtcattgaagccgaagaaatcaaagaggctgataaacttttaagacttaaa
gtagatatcggcaatggcgagattcgccagatcattgctggcatcaaagccgcctacact
gcggagtctctcttgaaccgtaagcttttagtttgtgtgaatttaaaaccacgcaaaatg
aaattcggaatgtcagagggtatggtccttgcggctggcagcggcggaagtgatttattt
gttcttagccctgacgaaggcgcccaagtcggccaaagagtgaagtaa

DBGET integrated database retrieval system