KEGG   Bdellovibrio bacteriovorus W: BDW_07130Help
Entry
BDW_07130         CDS       T03036                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbw  Bdellovibrio bacteriovorus W
Pathway
bbw00071  Fatty acid degradation
bbw00072  Synthesis and degradation of ketone bodies
bbw00280  Valine, leucine and isoleucine degradation
bbw00310  Lysine degradation
bbw00362  Benzoate degradation
bbw00380  Tryptophan metabolism
bbw00620  Pyruvate metabolism
bbw00630  Glyoxylate and dicarboxylate metabolism
bbw00640  Propanoate metabolism
bbw00650  Butanoate metabolism
bbw00900  Terpenoid backbone biosynthesis
bbw01100  Metabolic pathways
bbw01110  Biosynthesis of secondary metabolites
bbw01120  Microbial metabolism in diverse environments
bbw01130  Biosynthesis of antibiotics
bbw01200  Carbon metabolism
bbw01212  Fatty acid metabolism
bbw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BDW_07130
   00630 Glyoxylate and dicarboxylate metabolism
    BDW_07130
   00640 Propanoate metabolism
    BDW_07130
   00650 Butanoate metabolism
    BDW_07130
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BDW_07130
   00072 Synthesis and degradation of ketone bodies
    BDW_07130
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDW_07130
   00310 Lysine degradation
    BDW_07130
   00380 Tryptophan metabolism
    BDW_07130
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BDW_07130
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BDW_07130
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BDW_07130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbw04147]
    BDW_07130
Enzymes [BR:bbw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BDW_07130
Exosome [BR:bbw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BDW_07130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AHI05928
UniProt: W5WYE8
Position
complement(1480885..1482063)
Genome map
AA seq 392 aa AA seqDB search
MENVVIVSSVRTPVATFQGGFSSVPAPKLGAVAIKEALAKANVKPNEIEECIMGEVLTAG
VGQAPARQAALFAGLDNNVPCLTINKVCGSGLKAVMLAADSIALGNTKIAVAGGQENMTL
APHLLENSRSGYRMGPTQMTDSMIKDGLWDPYNNFHMGNAAEICVKEHNFTREEQDAFAI
DSYKKAQTAWEKGVFKNEIAPVVVEGRKGAVTIDKDEEPFNTNFDKIPGLRPAFDKAGTI
TAANASKINDGAAAHVLMSETEANKRGIKPLARIVAHGTFAHEPKYFTTAPVGAIKKALA
KANLNVGDVDLWEINEAFAVVTQVAMKELEIPAEKVNIHGGAVAIGHPIGASGARILTTL
VHALHTHNKRYGLATLCIGGGEAVALIIEAVR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgtcgtaatcgtaagcagcgtcagaactcctgtcgcaacttttcaaggtggt
ttttcttctgttccagctccaaagcttggcgctgttgctattaaagaagctttagctaaa
gccaatgtaaagccaaatgaaatcgaagaatgcattatgggcgaagtattaacagcgggt
gtgggacaagctcctgcgcgtcaggcggctctttttgcgggtcttgataacaatgtacca
tgcctaacaatcaacaaagtttgcggatctggccttaaagccgtgatgctagctgcggac
tctattgctttgggtaatacaaaaatcgcagtagctggtggtcaagagaacatgactttg
gctccgcatcttttagaaaactctcgttcaggctaccgcatggggccaactcaaatgacc
gactctatgattaaagatggtctttgggacccgtataacaatttccacatgggaaatgca
gcagagatctgcgtaaaagagcacaacttcactcgtgaagaacaagatgcttttgcaatc
gactcttacaaaaaagcccaaactgcttgggaaaaaggtgttttcaagaatgaaatcgcc
cctgttgtcgtagaaggccgtaaaggtgctgttactatcgacaaagacgaagagccgttt
aacacaaacttcgataagatccctggattgcgcccagctttcgataaagcaggaacaatc
acagcagctaatgcttctaaaattaacgacggagctgctgctcacgttttgatgtctgaa
acagaagctaacaaacgtggcattaaaccattagcacgcatcgtagctcatggcactttt
gcgcatgaaccaaaatacttcacaacagctccagttggcgcgattaaaaaagctctagca
aaagcaaatctaaatgttggtgatgtagatctttgggaaatcaacgaagctttcgcagtt
gttactcaagttgcaatgaaagaacttgagatcccagctgaaaaagtaaacatccatggc
ggcgcagtggcaatcggtcacccgatcggagcttctggtgctcgtattttaacaactctt
gtgcatgctcttcacactcacaataaacgctatggtcttgcgactctttgtatcggtggt
ggtgaagctgttgccttgatcattgaagctgttcgttaa

DBGET integrated database retrieval system