KEGG   Bdellovibrio bacteriovorus W: BDW_10800Help
Entry
BDW_10800         CDS       T03036                                 

Definition
(GenBank) putative mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bbw  Bdellovibrio bacteriovorus W
Pathway
bbw00051  Fructose and mannose metabolism
bbw00520  Amino sugar and nucleotide sugar metabolism
bbw01100  Metabolic pathways
bbw01110  Biosynthesis of secondary metabolites
bbw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BDW_10800
   00520 Amino sugar and nucleotide sugar metabolism
    BDW_10800
Enzymes [BR:bbw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BDW_10800
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BDW_10800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 Cupin_7 Cupin_1
Motif
Other DBs
NCBI-ProteinID: AHI06660
UniProt: W5X8F7
Position
complement(2284398..2285774)
Genome map
AA seq 458 aa AA seqDB search
MIPIVLSGGSGTRLWPVSRQQLPKQFCHILGKPLQTQTLERSFKLGQPLIVTSEDLRTMT
MVNLKENNMESVEVIFEPSSRNTAPAVAIVVQHLMNHGKSKAVAGIFPSDHLIKDEKAFA
AVTELAEKQALAGKVVTLGITPSYPETGYGYIQSLPETLEAAGALQAHPVKQFHEKPDLK
TAQEFLASGNFSWNAGIFVFQVEKMAELFAKYQPEIWNKVKTLKADLSNLAEVYSELPSI
SIDYAIMEKLSSLELACIPAEFGWSDVGSWDAVTEIRTSDEFASVESKNVSVMGVDSKAY
SFVGMTDVIVVDTADALLVMKKGESQKVKDIVEGFKKDRPAIIKEHRFEYRPWGYFEILK
DTETFKSKVIRVNPGAQLSYQSHERREEHWTITRGSGEVVLNDQVIPVKAGTYVHIPQQA
KHRMRNTGTEELEFIEVQLGTYFGEDDIKRYQDDYKRK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
ttgattccaatagttttatccggtggtagtggaacacgtttatggccggtatctcgtcag
cagctccctaaacagttttgtcatattttaggcaagcctcttcagacgcaaactttggaa
agatccttcaaacttggccagccacttatcgtgacttctgaagaccttcgtacaatgacc
atggtgaacttgaaagaaaacaacatggaatccgtagaggttatatttgaacctagtagt
cgcaatacagcgcccgctgtcgcgattgtggtgcaacatcttatgaatcacggaaaatca
aaagctgttgcgggtattttcccttccgaccatctaattaaagatgaaaaagcttttgct
gcggtgactgagttagctgaaaaacaagccttggctgggaaggttgttactttaggtatt
acaccttcatatccagagacaggttatggttacattcagagtctacctgaaactttagag
gcggctggggctttacaagctcatcctgtaaaacagtttcacgaaaaaccagatttgaaa
acagcacaagagtttttggcgtcaggcaacttctcttggaatgccggaatttttgttttc
caggttgaaaaaatggctgagctttttgcaaaataccaaccggagatttggaacaaagta
aaaactcttaaagcggatctttctaatttggcagaggtctattcagagctgccaagtatt
tctatcgattatgcgatcatggaaaaattatcttcactggagttggcgtgtattccggct
gagtttggttggagtgatgtgggctcttgggacgcggtcactgagattcgtacctcagac
gaattcgcctctgtagaatctaagaatgtttctgtaatgggtgttgattccaaggcctac
tcttttgtgggaatgacagatgtgattgttgtggatactgcggacgctcttttggtaatg
aaaaaaggcgagtctcagaaagtaaaagatattgtcgaaggctttaagaaagatcgtcca
gcaattatcaaagaacacagatttgaatatcgcccatggggatatttcgaaattttgaag
gatactgaaacttttaaatcaaaagttattcgtgtaaacccgggagctcaactttcttat
caatctcatgagcgacgcgaagaacattggacgatcactcgtggttcgggagaggttgtt
ttgaatgatcaagtgatcccagtgaaggcggggacctatgtacacattcctcaacaggcc
aaacaccgcatgcgtaatacgggaactgaggagctagaattcattgaagtccaactaggg
acttactttggagaagatgatattaagcgctaccaagatgactataagagaaaatag

DBGET integrated database retrieval system