KEGG   Bordetella bronchiseptica S798: BBS798_0538Help
Entry
BBS798_0538       CDS       T03637                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbx  Bordetella bronchiseptica S798
Pathway
bbx00071  Fatty acid degradation
bbx00072  Synthesis and degradation of ketone bodies
bbx00280  Valine, leucine and isoleucine degradation
bbx00310  Lysine degradation
bbx00362  Benzoate degradation
bbx00380  Tryptophan metabolism
bbx00620  Pyruvate metabolism
bbx00630  Glyoxylate and dicarboxylate metabolism
bbx00640  Propanoate metabolism
bbx00650  Butanoate metabolism
bbx00900  Terpenoid backbone biosynthesis
bbx01100  Metabolic pathways
bbx01110  Biosynthesis of secondary metabolites
bbx01120  Microbial metabolism in diverse environments
bbx01130  Biosynthesis of antibiotics
bbx01200  Carbon metabolism
bbx01212  Fatty acid metabolism
bbx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBS798_0538
   00630 Glyoxylate and dicarboxylate metabolism
    BBS798_0538
   00640 Propanoate metabolism
    BBS798_0538
   00650 Butanoate metabolism
    BBS798_0538
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBS798_0538
   00072 Synthesis and degradation of ketone bodies
    BBS798_0538
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBS798_0538
   00310 Lysine degradation
    BBS798_0538
   00380 Tryptophan metabolism
    BBS798_0538
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBS798_0538
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBS798_0538
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBS798_0538
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbx04147]
    BBS798_0538
Enzymes [BR:bbx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBS798_0538
Exosome [BR:bbx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBS798_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: BAO67264
Position
complement(576596..577768)
Genome map
AA seq 390 aa AA seqDB search
MAFQHPAFVAGAFEHPTRHAPDKSTAQLHAECARGALADAGLALEDVDGYFCAADAPGGI
PALMADYLNLRNLRHVDGTESGGCSYIAHVGHAADAIARGKCSVALITLAGKPRSSGQAT
GTEIRQIPPERPAAAFEQPYAWTVAGMYGLLARRHMHEYGTTMEQLAWVKVAASHHAQHN
PHALLRKRYTTEDVLGSPLVADPLRRMDCCVITDGGGALVLVAPHIAASLARPRVGVRGY
AETIRTNEAGRLDLLQTGAAVTGPRAFEMAGLAPADVKYASVYDNFTIMVALQLEDLGFC
AKGDGGRFVADGNLISGVGRLPWNTDGGGMCNNHPQNRGGITKVIEAVRQLRGEAHPAVQ
VPSCDIALATGPGLVMGAGHAHATVLLERI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcaacatcccgccttcgtggcaggcgccttcgaacaccccacccgtcatgcg
ccggacaaatccacggcgcaactgcacgccgaatgcgcgcgcggcgccctggccgacgcc
ggcctggccctggaggacgtggacggctacttctgcgccgcggatgcgccgggcggcatt
cccgcgctgatggccgattacctcaacctgcgcaacctgcgccatgtggacggcaccgaa
tcgggcggctgctcgtatatcgcgcacgtcggccacgcggccgacgccatcgcgcgcggc
aaatgctcggtggccctcatcacgctggcgggcaagccgcgcagcagcggccaggccacc
ggcaccgagatccgccagatcccgcccgagcggccggccgccgccttcgaacagccctat
gcctggacggtggccggcatgtacggcctgctggcgcgccgccatatgcacgaatacggc
acgaccatggaacagctggcgtgggtcaaggtggccgcgtcgcaccatgcccagcacaac
ccccacgccctgctgcgcaagcgctacacgaccgaagacgtactgggctcgccgctggtg
gcggacccgctgcgccggatggactgctgcgtcatcaccgacggcggcggcgcgctggtc
ctggtcgcgccgcacatcgccgcgtcgctggcgcgcccccgggtcggcgtgcgcggctac
gccgaaaccatccgcaccaacgaagccggccgcctggacctgctgcagaccggcgccgcc
gtcaccggcccgcgtgcgttcgagatggccggcctcgcgcccgccgacgtgaaatacgcc
tcggtgtacgacaacttcaccatcatggtggccctgcagctggaagacctgggcttttgc
gccaagggcgacggcggcaggttcgtggccgacggcaacctgatctccggcgtcggacgc
ctgccctggaacaccgatggcggcggcatgtgcaacaaccatccccagaaccgcggcggc
atcaccaaggtcatcgaagcggtgcgccagttgcgcggcgaagcgcaccccgccgtacag
gtgccctcgtgcgacatcgccctggcgacggggcccggcctggtaatgggcgccggccac
gcccacgcaaccgtgctgctggagcgcatatga

DBGET integrated database retrieval system