KEGG   Bordetella bronchiseptica S798: BBS798_3676
Entry
BBS798_3676       CDS       T03637                                 

Gene name
alcC
Definition
(GenBank) alcaligin biosynthesis protein
Organism
bbx  Bordetella bronchiseptica S798
SSDB
Motif
Pfam: IucA_IucC FhuF
Other DBs
NCBI-ProteinID: BAO70401
UniProt: P94255
Structure
PDB: 
2X0Q 2X0P 2X0O

Position
3988518..3990374
AA seq 618 aa
MSRTTPPHPAEIVAHLQPEIWNKVNRLLVRKAISEYAHEWLLEPQRLGPGETPGFERFRL
TLADGAQYDFDAQVMAMRHWRIPPESIVKTVAGVPAPLDALQFVIEIRDKLGLPVDRLPI
YMDEITSTLHGSAYKHGRTTLGAAALARADYQTIETSMIEGHPSFVANNGRLGFDAEDYH
GYAPEAATPVRLMWLAVHKDNAHFSCLSDMDYDSLMSEELGESAVTDFAARLREQGLHPA
DYYFMPAHPWQWFNKLSLAFAPYVAQRKIVCLGYGEEQYLAQQSIRTFFNISRPGKRYVK
TSLSILNMGFMRGLSPYYMAGTPAINEYIHDLISADPWLRANGFRILREVASMGFRNYYY
EAAIDTDTPYKKMFSALWRENPLTLIAPGQNLMTMAALLHVDPQGRALLPELIQASGLDA
GTWLERYVDAYLTPLIHCFYAHDLVFMPHGENVILVIQDGVPVRAFMKDIAEESSILNPQ
VRLPQAAQRLAADVPEAYKLLTIFVDVFEGYFRHLTQILVETELMPEHDFWRLVAGRIAA
YQQAHPQRLDKYRRYDLFAPDMIHSCLNRLQLANNLQMVNLADPIGSFQMAPNLPNPIAC
FRPSWLGSGEALQTLTAA
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgagccgcaccacccctcctcatcccgccgagatcgttgctcatctgcagccggaaatc
tggaacaaggtcaatcgcctgctggtgcgcaaggcgatatccgaatatgcacatgagtgg
ctgctcgaacctcagcgactcggtccgggcgaaacgccgggatttgaacgctttcgcctg
acactggctgacggcgcgcaatatgactttgacgctcaggtcatggccatgcgccattgg
cgtattccgcctgaatccatcgtaaagaccgtggccggggttccggcgccgctggatgcc
ctgcagttcgtgatagagatccgggacaaactcggcttgccggtggaccgtctgcccatc
tatatggacgaaatcaccagcactctacacggcagcgcctataaacatggccggacgacg
cttggcgccgcggcattggcacgagccgactaccagaccatagaaacatcgatgatcgag
ggccaccccagcttcgtggccaacaatggccgccttggctttgatgccgaggattaccat
ggctacgcgcccgaagctgccacgccggtgcgcttgatgtggctggcggttcacaaggac
aacgcgcatttttcctgcttgtccgacatggactacgacagcctgatgagcgaggagttg
ggtgagtccgctgtaacggatttcgccgcccgactgcgcgagcagggcctgcatcccgcg
gactactacttcatgcccgcccacccatggcaatggttcaacaagctgtccctggctttt
gccccctacgtcgcccagcgcaaaatcgtctgcctggggtacggcgaggagcaatacctc
gctcagcagtccatccgcacctttttcaacatcagccgacccggcaagcgctatgtgaag
acctcgctgtccattctcaacatgggattcatgcgcggcctgtcaccctactacatggca
ggtacgccagccatcaacgaatacatccatgacctgatatcggccgatccgtggctgcgc
gccaatggtttcagaattctgcgcgaagtcgcctcgatgggctttcgcaactactactac
gaagccgccatcgatacggacacaccgtacaagaagatgttctcggcgctttggcgcgag
aaccccctgacgctgatcgctcccggacaaaatctcatgaccatggctgcgctgctgcat
gtggacccacaaggccgggctttgcttcccgaattgatacaggcttcaggactggatgca
gggacttggctggagcgctatgtggacgcttatctgactccactgatccattgtttctat
gctcatgacctggttttcatgccgcacggtgaaaacgtgattctcgtcatccaggatggc
gtacctgtgcgcgccttcatgaaggacatcgcggaagagtcttccatcctcaatccgcag
gtcaggcttccgcaggcggctcagcgcctggccgccgatgtgccggaggcctataagctg
ctgacgattttcgtggatgtcttcgagggctatttccgccatctgacccagatcctggtt
gagacggaactgatgccggaacatgatttctggcggctagtggctgggcgcatcgccgct
tatcagcaagcgcatccgcaacggctcgacaagtatcggcgctacgacttgtttgcgccc
gacatgatccattcgtgcctgaaccgcctgcaattggccaacaatctgcagatggtcaac
ctggccgatcccattggcagtttccaaatggcccccaatctgcccaaccctatcgcctgc
ttccgtccgtcgtggctgggtagcggcgaagccctgcagacgctgacggccgcatga

DBGET integrated database retrieval system