KEGG   Bacillus bombysepticus: CY96_02515Help
Entry
CY96_02515        CDS       T03597                                 

Definition
(GenBank) phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bby  Bacillus bombysepticus
Pathway
bby00562  Inositol phosphate metabolism
bby00564  Glycerophospholipid metabolism
bby01100  Metabolic pathways
bby01110  Biosynthesis of secondary metabolites
bby02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CY96_02515
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CY96_02515
   00565 Ether lipid metabolism
    CY96_02515
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CY96_02515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bby02042]
    CY96_02515
Enzymes [BR:bby01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     CY96_02515
Bacterial toxins [BR:bby02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   CY96_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_dep_PLPC S1-P1_nuclease
Motif
Other DBs
NCBI-ProteinID: AHX16938
UniProt: A0A023P2K7
Position
518192..519043
Genome map
AA seq 283 aa AA seqDB search
MKKKVLALAAAITLVAPLQSVAFAHENDGGQRFGVIPRWSAEDKHKEGVNSHLWIVNRAI
DIMSRNTTLVKQDRVALLNEWRTELENGIYAADYENPYYDNSTFASHFYDPDNGKTYIPY
AKQAKETGAKYFKLAGESYKNKDMKQAFFYLGLSLHYLGDVNQPMHAANFTNLSYPQGFH
SKYENFVDTIKDNYKVTDGNGYWNWKGTNPEDWIHGAAVVAKQDYAGIVNDNTKDWFVRA
AVSQEYADKWRAEVTPMTGKRLMDAQRVTAGYIQLWFDTYGNR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaagtacttgctttagcggcagctattacattagttgctccattacaaagt
gttgcatttgctcatgaaaatgatgggggacagagatttggagttattccgcgctggtct
gctgaagataaacataaagaaggcgtgaattctcatttatggattgtaaaccgtgcaatt
gatattatgtctcgtaatacaacacttgtaaaacaagatcgagttgcactattaaatgaa
tggcgtacggagttagagaacggtatttatgctgctgactatgaaaatccttactatgat
aatagcacatttgcttcacatttctatgaccctgacaatgggaaaacttatattccgtat
gcaaagcaggcaaaggaaactggagctaagtattttaaattagctggtgagtcttacaaa
aataaagatatgaaacaagcattcttctatttaggattatctcttcattatctaggggat
gtaaaccaaccgatgcatgcagcaaactttacgaacctttcgtatccacaagggttccat
tctaaatatgaaaactttgtagatacgataaaagataactataaagtaacggatggaaat
ggatattggaactggaaaggtacgaatccagaagattggattcatggagcggcagtagtt
gcgaaacaagattacgctggcattgtaaatgataatacgaaagattggttcgtgagagct
gctgtatcacaagaatatgcagataaatggcgcgctgaagttacaccaatgacaggtaag
cgtttaatggatgcacaacgtgttactgccggatatattcagctttggtttgatacgtac
ggaaatcgttaa

DBGET integrated database retrieval system