KEGG   Bacillus bombysepticus: CY96_24345Help
Entry
CY96_24345        CDS       T03597                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bby  Bacillus bombysepticus
Pathway
bby00450  Selenocompound metabolism
bby00970  Aminoacyl-tRNA biosynthesis
bby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CY96_24345
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CY96_24345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bby01007]
    CY96_24345
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bby03016]
    CY96_24345
Enzymes [BR:bby01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CY96_24345
Amino acid related enzymes [BR:bby01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CY96_24345
Transfer RNA biogenesis [BR:bby03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CY96_24345
 Prokaryotic type
   Other AARSs
    CY96_24345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Laminin_EGF zinc-ribbons_6
Motif
Other DBs
NCBI-ProteinID: AHX20998
UniProt: A0A023PE21
Position
complement(4689369..4691003)
Genome map
AA seq 544 aa AA seqDB search
MSIFIGGAWPYANGSLHLGHIASLLPGDILARYYRAKGENVLYVSGSDCNGTPIAIRAKQ
EGVTAKEIADKYHEEFQRCFRSLGFTYDCYTRTDSEHHHETVQNVFLRLLEEGHIYKKTV
EQAYCETCTQFLPDRYVEGICPHCHEAARGDQCDACSAILDPLDLLEKKCKLCGSTPSVQ
ETEHFYFALHTFQQKIKKVVEIAKEKGTWRDNAIQLTERYVKEGLQDRAVSRDLPIGVPI
PVEGYEDKKIYVWIEAVTGYYSASKHWVEETGKDDQEFWASEAKTYYVHGKDNIPFHSVI
WPAVLLGIGEEAIPRHIVSNEYLTVEKRKLSTSKNWAVWVPDILERYDPDSIRYFLTVNA
PENRDTDFSWREFIYSHNSELLGAYGNFVNRTLKFIEKYYGGIVPKGSIEVELKDKVEGL
YKQVGEAIEQTKFKVALETVFDTVRFANKYFDEKQPWKQREDDPVSCEETIYNCVYLIAN
FAHLLEPFLPFSSERVRNTLSIVKRNWEPQNTLPSRIDSVQPLFERIDVKQIEHEIEKLY
GAVK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttattggaggcgcttggccgtatgcaaatggttcgttacaccttggccat
attgcgagtttgttacctggagatattttagcgcgttattacagggcaaaaggtgagaat
gtgctgtatgtttcagggagtgattgtaatggaacaccgattgcaattagggcaaaacaa
gaaggtgtgacagcgaaagaaattgctgataagtatcatgaagagttccagcgatgtttt
cgtagccttggttttacttatgattgctatacacgtacagatagtgagcaccatcatgaa
acggttcaaaatgtttttttacgtttattagaagaaggacatatttataaaaaaacagtg
gaacaagcgtattgtgaaacgtgtacgcagtttttaccggatcgttatgtagaaggaata
tgtccacattgccatgaagcagcaagaggagatcaatgcgatgcgtgttcagctatttta
gatccactcgatttgttagaaaagaaatgtaagttatgtggtagtacaccatccgtacag
gaaacagagcatttctattttgcgttgcatacatttcagcagaaaattaaaaaagttgta
gaaatcgcaaaagaaaaaggaacatggcgtgataatgcaattcaattaacagaaagatat
gtaaaagaagggttacaagatagggcagtatcaagagatttaccaattggggtaccaatt
ccagtagaagggtatgaagataagaaaatttacgtatggattgaagcagtgacaggctat
tattcagcgagtaaacattgggttgaagaaacagggaaagatgatcaagagttttgggct
agcgaagcgaaaacatattatgtgcacggaaaggataatattccgtttcattccgtcatt
tggccagcggtattacttggaataggggaggaagcaatcccgcgtcatatcgtttcgaat
gaatatttaacagttgaaaaaagaaaattatctacaagtaaaaactgggcagtatgggtg
cctgacatattagaacgctatgatccagattctattcgttactttttaaccgtcaacgca
ccagaaaatcgcgatactgatttttcatggcgggaatttatttacagtcataatagtgaa
ttattaggtgcatacgggaactttgtgaaccggacattaaagtttattgaaaaatattat
ggtggtatcgtgccgaaaggaagtattgaagtagagctgaaagataaagtagaaggatta
tataaacaggtaggagaggcgattgagcaaactaaatttaaggtggcgctagagacagta
tttgatacagtacgttttgcaaataaatattttgatgaaaagcagccttggaaacaaaga
gaagatgatccagtttcatgtgaagaaacgatttataactgtgtgtatcttatcgctaat
tttgcccatctccttgagccatttttaccattttcaagtgaaagagttcgaaacacattg
tcgattgtgaaacgaaattgggaaccgcaaaatacgttgccaagtagaattgatagcgta
cagccattatttgagcgaatcgatgtaaaacaaattgagcatgagatagagaagctgtat
ggagcggtaaaatga

DBGET integrated database retrieval system