KEGG   Bacillus bombysepticus: CY96_25850Help
Entry
CY96_25850        CDS       T03597                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bby  Bacillus bombysepticus
Pathway
bby00071  Fatty acid degradation
bby00072  Synthesis and degradation of ketone bodies
bby00280  Valine, leucine and isoleucine degradation
bby00310  Lysine degradation
bby00362  Benzoate degradation
bby00380  Tryptophan metabolism
bby00620  Pyruvate metabolism
bby00630  Glyoxylate and dicarboxylate metabolism
bby00640  Propanoate metabolism
bby00650  Butanoate metabolism
bby00900  Terpenoid backbone biosynthesis
bby01100  Metabolic pathways
bby01110  Biosynthesis of secondary metabolites
bby01120  Microbial metabolism in diverse environments
bby01130  Biosynthesis of antibiotics
bby01200  Carbon metabolism
bby01212  Fatty acid metabolism
bby02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CY96_25850
   00630 Glyoxylate and dicarboxylate metabolism
    CY96_25850
   00640 Propanoate metabolism
    CY96_25850
   00650 Butanoate metabolism
    CY96_25850
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CY96_25850
   00072 Synthesis and degradation of ketone bodies
    CY96_25850
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CY96_25850
   00310 Lysine degradation
    CY96_25850
   00380 Tryptophan metabolism
    CY96_25850
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CY96_25850
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CY96_25850
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CY96_25850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bby04147]
    CY96_25850
Enzymes [BR:bby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CY96_25850
Exosome [BR:bby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CY96_25850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHX21281
UniProt: A0A023PDT4
Position
complement(4986778..4988061)
Genome map
AA seq 427 aa AA seqDB search
MYTTLERGAMIAPLLNVGIPSERSVLKNEMGERNMSKTVILSAARTPVGKFGGSLKDVKA
TELGGIAIKAALERANVAASDVEEVIFGTVIQGGQGQIPSRQAARAAGIPWEVQTETVNK
VCASGLRAVTLADQIIRTGDQSLIVAGGMESMSNSPYILRGARWGYRMGNNEVVDLNVAD
GLTCAFSGTHMGVYGGEVAKEDGISREAQDEWAYRSHQRAVSAHKEGRFEEEIVPVTIPQ
RKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKTATVTAGNAPGLNDGGAALVLMSEDRAK
QEGRKPLATILAHTAIAVESKDFPRTPGYAINALLEKTGKKIEDIDLFEINEAFAAVAIA
STEIAGIDPEKLNVNGGAVAMGHPIGASGARIIVTLIHALKQRGGGIGIASICSGGGQGD
AVMIEVH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaactttagaaagaggtgcaatgattgcacctcttctcaacgtagggataccg
agcgagcgctcagtgttaaaaaatgaaatgggggaaagaaacatgagtaaaacagttatt
ttaagtgctgcaagaacaccagttggaaaatttggaggatctttaaaagatgtaaaagcg
acggaacttggaggaattgcaattaaagcagcgcttgaaagagcaaatgttgcggctagt
gatgttgaagaagttatatttggaacggttattcaaggtggacaggggcaaattccatcg
cgccaagctgcgagggctgctggaatcccttgggaagtgcagacggaaacagtgaataaa
gtttgtgcatcaggacttcgtgcggttacgttagcggatcagattattcgtactggcgat
caatcactgattgtagccggcggtatggagtcgatgagtaacagtccttacattttacgc
ggagcaagatggggatacagaatgggtaacaacgaagttgttgatttaaacgttgctgac
ggtttaacatgcgcattttcaggtacacacatgggcgtttatggcggagaagttgcgaag
gaagatggaatttctcgcgaagcgcaagatgaatgggcatatcgtagccatcagcgtgcg
gtttcagcgcataaagaagggcgttttgaagaggaaatcgtgccagtaacgattccgcaa
agaaaaggcgatcctattgtcgttgcaaaggatgaggcgccacgtgaagatacaacgatt
gaaaagttagcaaagttaaaacctgtatttgataagacagcgacggtgacagctggtaat
gcgccgggactaaatgatggtggtgccgcacttgtattaatgagcgaagacagagcgaag
caagaaggaagaaagccattagcgacaattttggcgcatacagcaattgcagtggaatct
aaagatttcccaagaacgccaggttatgcaattaacgcattgcttgaaaaaacaggcaag
aaaattgaagacatcgatttattcgagattaatgaagcatttgcagcggtagcaattgca
agtacagaaatcgcaggaattgatccggaaaaattgaatgtaaatggcggcgcggtagcg
atgggacatccaattggagcaagcggagcgcgcattatcgttacactaatccatgcactt
aagcagcgcggcggcggaattggaattgcttcgatttgtagcggtggcggtcaaggggac
gcagtgatgattgaagtccattaa

DBGET integrated database retrieval system