KEGG   Borreliella burgdorferi ZS7: BbuZS7_0653Help
Entry
BbuZS7_0653       CDS       T00807                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
bbz  Borreliella burgdorferi ZS7
Pathway
bbz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BbuZS7_0653 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbz03400]
    BbuZS7_0653 (recB)
Enzymes [BR:bbz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BbuZS7_0653 (recB)
DNA repair and recombination proteins [BR:bbz03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BbuZS7_0653 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 PDDEXK_1 Viral_helicase1 AAA_30 UvrD_C_2 AAA_22 PhoH DEAD Helicase_RecD
Motif
Other DBs
NCBI-ProteinID: ACK74949
UniProt: A0A0H3C3U0
Position
complement(661018..664527)
Genome map
AA seq 1169 aa AA seqDB search
MNKILEKIQNNTTILIEASAGTGKTHILENVVINLIKTKLYSINEILVLTFTKKATEEMH
TRILKVIENAYSNSKTNEILKEAYEQSKKLFISTINKFALHALNNFQIETENYSKYKPKE
KFSKEIDEIVYDFLRKSDSLIQALDIKDYELKVFKSDAKKTEEIVLKIKKAYERDTTQEL
GDWLKTQTAFENILLKKEELIKDYNKIIEDLDKMTKDEILSFYNKHIQTGKLEIEYSKEN
DIFKIAETLLKNKFFSTLIEKETKKNSKLSPKELKIKNDLICLGINIKHEKYKSEDNRNK
NRNNLKHYVILKVEYKILKYIEKELEKTIKSTNTIDQNYIISNLKNYLKSEDKKLLNAIK
NRYKIILIDEAQDLSLIQIEIFKILKTAGIKLIFIADPKQIIYSFRKADISFYNKEIKNK
INTDARIVLKINHRSSKKLIGPLNKIFNNIYNNAIADEIEKIDFTNSLPNQKNDNNKIVI
NGQEIEGINIITTNTESEEDIYQKTALTIKYLLAYGKIAENNKIRNIKMQDIKVLCRGKN
EINLIDKALKKEQIQTNKTQEKFLKTKEFSEIFYIIKCLDRKQSFKTLNYILSSKILNVP
WNLQRILIKQDKIHLIEEFIENIIVLLEKNEITLINAINKITFEKNLWIKIANITKDQKI
IEWAKNKINYKGLLIKEGKLENLKTYETTLEIISKIYHKEQNIQSLISTLESLIINEEPE
EIEEKINNINNDNESIELMTIHKSKGLGMNIVFLLNTTPIENSNFFSKKNQFYKFYQDGK
IEYDFFKLEENKKYARLKILSEEKNIFYVGATRAKFALFIIKINSITSKLLEIAKIFTID
DIKHDFNIHEFIGQKRFNKKKYNTNVNTKLIPPKPIIKNMFKKEYTSSFSSLTAQAHHKE
FYENYDFKNINYEKETELDYEPGLEETMPKGKDIGNILHAAMEEIIFSTAKDTFDNFKKN
NIEIIEKQIQKINSNLNTIEIQNSLAKMIYNILTYNIRAINTRLCDIEELQKEMEFLIKI
NPEFQKQKYLFDKHFEDLHIKLSDGYLKGIVDLIFKANNKIYILDYKTNYLGKNKEDYNI
TNLENTIKKEYYDLQYKIYALGIKKILFKNKKEYNQKFGGIIYLFTRAFKDNIECLKSKF
ENGIYFNLPKFNDVDLDKIILELGIKRHL
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatcctagaaaaaattcaaaataacacaacaatattaatagaagcatcggcg
ggcaccggaaaaactcacatactggaaaatgtggttataaatttaataaaaaccaagcta
tactccataaatgaaatcttggtattaacttttacaaaaaaagccacagaagaaatgcac
acaagaatactaaaagtaatagaaaatgcttattctaactcaaaaacaaatgaaatctta
aaagaagcttatgagcaatcaaaaaaactctttatatcaacaatcaataaatttgcatta
catgccttaaataattttcaaattgaaacagaaaattactccaaatataaacctaaagaa
aaattttcaaaagaaatagatgaaatagtttatgactttttaagaaaatcagatagcttg
attcaagctcttgatattaaagactacgaacttaaagtgtttaaatctgatgctaaaaaa
acagaagagattgttttaaaaataaaaaaagcttacgaaagagatacgactcaagagctt
ggagattggcttaaaacccaaacggcttttgaaaacattcttcttaaaaaggaagagctg
atcaaagattacaacaaaataatagaagacttagataaaatgacaaaagatgaaatatta
agtttttataataaacatattcaaactggcaaacttgaaatagaatactctaaagaaaat
gacatattcaaaatagcagaaacattattaaaaaataaatttttttcaactctaatagaa
aaagaaactaaaaaaaattctaaattatcgcctaaagaacttaagattaaaaatgattta
atctgtttgggaattaatattaaacatgaaaaatataaatcagaagacaatagaaataaa
aatagaaacaatttaaagcactatgtcattttaaaagttgaatacaaaatactaaagtat
atagaaaaagaactagagaaaactattaaatcaacaaacacaatagatcaaaattacata
atttcaaatttaaaaaattacttaaaatcagaagacaaaaagcttctaaatgcaatcaaa
aatcggtacaaaatcattttaattgatgaggcgcaagatttaagcctaatacaaattgag
atatttaaaatattaaaaacagcaggaataaaattgatattcatagccgatccaaaacag
ataatatattcctttagaaaagcagacatttcattttataacaaagaaataaaaaataaa
atcaatacagacgctagaattgtactaaaaataaatcacagatcaagtaaaaaactcata
gggcctttaaataaaatttttaataatatatacaataatgcaatagccgatgaaattgaa
aaaattgattttaccaattcacttccaaatcaaaaaaacgacaataataaaattgtcatc
aacggacaagaaatagaaggaatcaatataataaccacaaatacagaaagcgaagaagac
atttaccaaaaaacagcattaacaataaaatatttgcttgcatatggaaaaattgctgag
aacaataaaattagaaatattaaaatgcaagacattaaagtactttgcagaggaaaaaat
gaaatcaatttaattgataaagcattaaaaaaagagcaaatccaaacaaacaaaactcaa
gaaaaatttttaaaaaccaaagaatttagcgaaattttttatattattaagtgcttagac
cgaaagcaaagttttaaaactctaaattatattctaagcagcaaaatattaaatgtgccg
tggaatttacaaagaattttaatcaaacaagacaaaattcaccttatagaagaatttatt
gaaaatataatagttttgcttgaaaaaaatgaaataacattaataaatgcaattaacaaa
attacattcgaaaaaaacctgtggatcaaaattgcaaatatcaccaaagatcaaaaaatt
atcgaatgggcaaaaaataaaataaattacaaaggtcttcttattaaagaaggtaagctt
gaaaatttaaaaacctatgaaacaacgcttgagatcatctctaaaatatatcataaagaa
caaaacatacaatctctaatctctactttagaaagcctaataataaacgaagaacctgaa
gaaatagaagaaaaaataaataatataaataatgataatgaatctatagaactcatgaca
atacacaaatcaaaagggcttggcatgaatattgtattcttactaaatacaactccaata
gaaaatagcaattttttttcaaaaaaaaatcaattttacaaattttatcaagacggaaaa
attgaatatgatttttttaaattggaagaaaataaaaaatacgcaagactaaaaatacta
agcgaagaaaaaaatatattttatgtgggagcaacaagagctaaatttgctctttttatt
ataaaaataaatagcataactagcaaattactagaaatagcaaaaatttttactatcgat
gatattaaacatgactttaacatacatgaatttattggccaaaagagattcaataaaaaa
aaatacaatacaaatgtaaatacaaaattaattccgccaaaaccaataattaaaaacatg
tttaaaaaagaatatacatctagtttttcaagtttaaccgcgcaagctcatcataaagaa
ttttacgaaaactatgattttaaaaatattaactacgaaaaagaaacagaacttgattat
gagcctggattagaagagactatgcccaaaggaaaagacatcggaaacattttacatgca
gcaatggaggaaataatctttagcacagcaaaagatacatttgataattttaaaaaaaat
aacattgaaattattgaaaaacaaatacaaaaaattaactcaaatctcaatacaatagaa
atacaaaattcattagctaaaatgatttataatatactaacttataatataagagcaatt
aatactcgtctgtgtgatattgaagaattacaaaaagaaatggaatttttaataaaaata
aatcctgaatttcaaaaacaaaaatatctttttgacaaacactttgaagatcttcacata
aaactaagtgatggatatttaaaaggaatagtagatcttatatttaaagctaataataaa
atatatatcctagattacaaaacaaactatcttggaaaaaataaggaagattataatata
acaaatttagaaaatacgataaaaaaggaatattatgatttgcaatataaaatatatgct
cttggaataaaaaaaatattatttaaaaacaaaaaagaatataatcaaaaatttggtgga
ataatatatctttttacaagagcatttaaagacaatattgaatgcttaaaatcaaaattt
gaaaatggtatttattttaatcttccaaaatttaacgacgtggatttagataaaatcatc
ttagagttaggcattaaaagacacttatga

DBGET integrated database retrieval system