KEGG   Borrelia burgdorferi ZS7: BbuZS7_0678Help
Entry
BbuZS7_0678       CDS       T00807                                 

Definition
(GenBank) putative phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbz  Borrelia burgdorferi ZS7
Pathway
bbz00010  Glycolysis / Gluconeogenesis
bbz00260  Glycine, serine and threonine metabolism
bbz00680  Methane metabolism
bbz01100  Metabolic pathways
bbz01110  Biosynthesis of secondary metabolites
bbz01120  Microbial metabolism in diverse environments
bbz01130  Biosynthesis of antibiotics
bbz01200  Carbon metabolism
bbz01230  Biosynthesis of amino acids
Module
bbz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BbuZS7_0678
  Energy metabolism
   00680 Methane metabolism
    BbuZS7_0678
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BbuZS7_0678
Enzymes [BR:bbz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BbuZS7_0678
Membrane trafficking [BR:bbz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BbuZS7_0678
Exosome [BR:bbz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BbuZS7_0678
  Exosomal proteins of melanoma cells
   BbuZS7_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACK74778
UniProt: B7J2L3
Structure
PDB: 

Position
693590..694336
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSR
ANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVP
PMSLDESDDRHPIKDPRYKHIPKRELPSTECLKDTVARVIPYWTDEIAKEVLEGKKVIVA
AHGNSLRALVKYFDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDESKIKKAMES
VASQGKLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtaagacacggagagagtgagtggaataaagaaaatcttttt
actggttggacagatgttaaactttctgacaagggtatcgatgaggctgttgaggcgggt
ttgcttctcaaacaagaaggctattcttttgatattgcttttagttctttgttgtcaaga
gctaatgacactttaaatattattttgcgagaattagggcaatcttatattagtgtaaaa
aaaacctggagattaaatgaaaggcactatggagctttgcaaggtttaaataagtcagaa
acagctgcaaaatatggggaagataaggttttaatttggagacgtagttatgatgtgccc
ccaatgtctttggatgagtctgatgatcgtcatcccataaaagatccaagatataaacat
atccccaaaagggaacttccttcaacagagtgccttaaagatactgttgcaagagttatt
ccttattggactgatgagattgcaaaagaagttcttgaaggtaaaaaagttattgttgct
gctcacggtaattctttaagagcgcttgttaaatattttgacaatttaagtgaagaagat
gttttaaagcttaacattcccacaggcattcctttagtttacgaattagataaagattta
aatcccattaaacattactatctaggtgatgagagcaaaattaaaaaggcaatggaatct
gttgctagtcaaggaaagttaaagtaa

DBGET integrated database retrieval system