KEGG   Bacillus cereus ATCC 10987: BCE_0376
Entry
BCE_0376          CDS       T00162                                 
Name
(GenBank) phage-related protein
Organism
bca  Bacillus cereus ATCC 10987
SSDB
Motif
Pfam: DUF2815
Other DBs
NCBI-ProteinID: AAS39312
UniProt: Q73EI2
Structure
Position
394909..395457
AA seq 182 aa
MNNQNRTKVVTSVNTRLSYFHGWEPVSINGGAEKYSVSVLIPKTDKETINAINAAVDAAI
EEGIAKFGGKKPNKAAIKLPLRDGDVERDDEAYKGHYFVNANSKTPPQIVDKAVRPILDR
NEVYSGCYARVSLNFYAFNSNGNKGVACGLGNIQKIRDGEPLGGRTNAADDFTTIEDDDF
LA
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaataatcaaaacagaacgaaggttgttacaagcgtcaacacacgtcttagctacttt
cacggctgggaacccgtatccatcaatggcggagcggaaaagtacagcgtatctgtattg
attcccaaaacagataaggaaactatcaatgctatcaatgcagcagtagatgcagccatt
gaagagggcattgcaaagtttggtggtaaaaagccgaataaggcggctatcaaactgcca
cttcgtgatggtgatgtagaacgtgatgatgaggcttataaagggcattattttgtaaat
gccaacagcaagactccaccccaaatagtagataaagcagtcagacctatcttggatcgc
aacgaggtgtacagtggttgttatgcaagagtatccctaaatttctacgcttttaactct
aatggcaataagggtgtagcttgtggtcttggcaacatccaaaagataagagatggggag
cctttaggtggaagaaccaatgcagctgatgatttcacaactattgaagatgatgatttt
ctagcataa

DBGET integrated database retrieval system