KEGG   Bacillus cereus ATCC 10987: BCE_0473Help
Entry
BCE_0473          CDS       T00162                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00220  Arginine biosynthesis
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01130  Biosynthesis of antibiotics
bca01230  Biosynthesis of amino acids
Module
bca_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BCE_0473 (argF)
Enzymes [BR:bca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BCE_0473 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AAS39408
UniProt: Q73E86
Position
484053..485051
Genome map
AA seq 332 aa AA seqDB search
MLMTRPNLKGRSFLAEKDFTQEELLYFLDLAAELKEKKKNGIPHHYLEGKNVALLFEKTS
TRTRCAFTVACTDLGANPEYLGKSDIQLGKKESVEDTAKVLGRMFDGIEFRGFNHETVES
LAQNSGVPVWNGLTDMWHPTQTLADLLTIREHVGKLKNVKLVYVGDGRNNVANSLLVGGA
IVGMDVRICTPETLWPAQEVIDLAKKYNEQVMITSNVEEAVANADVIYTDVWVSMGEEEK
FAERVKLLKPYQVNMKMIKETGNENVIFLHCLPAFHDVETMYGEEVYEKYGLKEMEVTDE
VFRSKHSKVFDQAENRMHTIKAVMAATLGNME
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgactagaccaaatttaaaaggaagaagctttctagcagaaaaagattttaca
caagaagaattgttatattttctagatttggcagcagaattaaaagagaaaaagaaaaat
ggaatcccgcatcattatttagaaggtaaaaatgtagcgctcttatttgaaaaaacttct
actcgtacgcgttgtgcatttacagtagcatgtacagatttaggggcaaatcctgaatat
ttagggaaaagtgatattcagcttgggaaaaaagaatctgtagaggatacagcaaaagtg
ttagggcgtatgtttgacggaattgagtttcgtggatttaatcatgaaactgtagaatct
ttagcacaaaattctggtgtgccggtttggaatggattaacagatatgtggcatccaaca
caaacactagcagatttattaacaattagagaacatgtagggaaactgaaaaatgtgaag
ctcgtttacgttggagatggacgaaataatgttgctaatagcttactagttggtggcgca
atcgttggaatggatgtacgtatttgtacaccggaaactttatggcctgcacaagaagta
atagatttagcaaaaaaatataatgaacaggtaatgataacaagtaatgtggaagaagca
gttgcgaatgcagatgtaatttatacagatgtatgggtgtctatgggggaagaagaaaaa
tttgctgaacgtgtcaagttattgaaaccttatcaagtaaatatgaaaatgattaaagaa
acagggaatgaaaacgtgattttcttacattgtttacctgcatttcatgatgtcgaaacg
atgtatggcgaagaagtttatgagaaatatgggttgaaagaaatggaggtaactgacgaa
gtattccgcagtaaacattcaaaagtatttgatcaagctgaaaatagaatgcatacaatt
aaagcggttatggcagctactttaggaaacatggagtaa

DBGET integrated database retrieval system