KEGG   Bacillus cereus ATCC 10987: BCE_0795Help
Entry
BCE_0795          CDS       T00162                                 

Definition
(GenBank) transcriptional activator TenA, putative
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00730  Thiamine metabolism
bca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCE_0795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bca03000]
    BCE_0795
Enzymes [BR:bca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BCE_0795
Transcription factors [BR:bca03000]
 Prokaryotic type
  Other transcription factors
   Others
    BCE_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AAS39727
UniProt: Q73DB8
Position
829135..829830
Genome map
AA seq 231 aa AA seqDB search
MKFCDRLLETVQPVWEMSHNHPFVVGMGDGTLEKDKFQYYIIQDYLYLLDYAKLYAIGVV
KATNPQVMGKFAEQIDGILNGEMTIHKQYAKRLGISIEEIESAKPSAKNLAYTNYMMSVS
QNGTLAELIAALLPCMWSYWEIGKRLNDIPGARDHEFFGEWIQGYSSEEYGNLCVWLIDL
LNEMAVGKSEKELDRLEEIFLYSSRFEYLFWDMSYRKEMWGFEEQEHTTVS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttgcgatagattattagaaactgtacaaccagtttgggagatgagtcataat
catccatttgttgtaggtatgggggatggtacgttagaaaaagataagtttcagtattat
attattcaagattatttatacttgttagattatgcaaagttatatgcgatcggtgttgta
aaggcaacaaatccacaagttatggggaaatttgctgaacaaattgatgggatattaaat
ggagaaatgaccattcataaacagtatgcaaaaagacttggaatttctatagaggagata
gagtctgcaaagccatctgctaaaaatttagcttatacaaattacatgatgtctgtatct
caaaatggcacacttgcggaattaatagcagcacttcttccatgtatgtggagctactgg
gagattggaaagcgtttaaatgatattcctggagcaagagatcatgagttctttggtgag
tggattcaaggctatagctctgaagaatatggcaacctttgtgtttggttaatcgattta
ttaaatgaaatggcagttggaaagtctgaaaaagagctagatcgattagaggagattttc
ctatattccagtcgatttgaatatttattctgggatatgtcctaccgtaaggagatgtgg
ggatttgaggagcaagaacatactacagtttcataa

DBGET integrated database retrieval system