KEGG   Bacillus cereus ATCC 10987: BCE_1822Help
Entry
BCE_1822          CDS       T00162                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00010  Glycolysis / Gluconeogenesis
bca00260  Glycine, serine and threonine metabolism
bca00680  Methane metabolism
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01200  Carbon metabolism
bca01230  Biosynthesis of amino acids
Module
bca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bca_M00002  Glycolysis, core module involving three-carbon compounds
bca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_1822
  Energy metabolism
   00680 Methane metabolism
    BCE_1822
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCE_1822
Enzymes [BR:bca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCE_1822
Membrane trafficking [BR:bca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCE_1822
Exosome [BR:bca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCE_1822
  Exosomal proteins of melanoma cells
   BCE_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAS40748
UniProt: Q73AF7
Position
1760821..1761396
Genome map
AA seq 191 aa AA seqDB search
MTIIYFVRHAHSTYTKEERERPLSEKGHLDAENVTSLLKDKHIDVVISSPYKRAVQTVQG
IANTYDVSIQIEEDLRERLLSSEPVADFNDAVQKVWEDWDFAYEGGESNDVAQRRAVICM
QNILKKYEGKNIVIGTHGNIMVLLMNYFDSKYDFRFWKTIRMPDIFKLNFHNEDLVSAER
IENTGHQINNL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaataatatatttcgttcgccatgcccattctacctatacaaaagaagaacgggag
cgtcctttatctgaaaaaggacacttggatgcagagaatgtaacaagcttattaaaagat
aaacatattgatgtagtgatttctagcccgtacaaaagagcagttcaaactgtacaagga
attgctaatacatatgatgtatcgatacaaatagaagaagatttacgagaaaggttatta
agttcagagccagtagcagattttaatgatgcggtccaaaaggtgtgggaagattgggat
tttgcatacgaaggcggagaatcgaatgatgtagcgcaaaggcgtgctgtaatatgtatg
caaaatatattaaaaaaatatgaaggtaagaatattgtaataggaactcatgggaatatt
atggtattactcatgaattattttgattcaaaatatgattttcgattttggaaaacaatt
cgtatgcccgatatatttaagttgaattttcataatgaggatttagtttctgccgaaagg
atagagaatacgggtcatcagataaataatttgtaa

DBGET integrated database retrieval system