KEGG   Bacillus cereus ATCC 10987: BCE_2106Help
Entry
BCE_2106          CDS       T00162                                 

Definition
(GenBank) NADH:flavin oxidoreductase / NADH oxidase family protein
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
bca  Bacillus cereus ATCC 10987
Brite
KEGG Orthology (KO) [BR:bca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCE_2106
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     BCE_2106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Dus G3P_antiterm nsp9
Motif
Other DBs
NCBI-ProteinID: AAS41027
UniProt: Q739N4
Position
complement(2029214..2030251)
Genome map
AA seq 345 aa AA seqDB search
MNYKLFSPYTIKDVTLKNRIVMSPMCMYSSENGDGQVTNFHLIHYGTRAAGQVGLVMIEA
TAVLPEGRISNKDLGIWDDSLIEGLHKTTTFIHDNGAKAAIQLAHAGRKAELETDALAPS
AIPFNETMKMPIEMSKHQIKDTVLAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPLTN
KRTDEYGGSPENRYRFLREIIDSINEVWNGPLFVRISANDYHPDGLTVQDYVQYTKWMKE
QGVDLIDCSSGAVVPARIDVYPGYQVQYAKHIKEHANIATGAVGLITTGAQAEQILNNNE
ADLIFIGRELLRNPYFPRIAANELGFELEEPYQYERAPGKISTNK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaacttttttcaccttatacaattaaggatgttacattaaaaaaccggatt
gttatgtcacctatgtgcatgtattcatcggaaaacggggatggccaagtaacaaatttc
catctcattcattatggaacaagagctgccggtcaagttggtttagttatgattgaagca
acagccgtgttacctgaaggtcgaatttcaaataaagacttaggcatttgggatgacagt
ttaattgaaggcttacataaaacgacaacttttatacacgataatggtgcaaaagctgcc
atccaactcgctcacgctggaagaaaagcagaattagaaacagatgcgttagctccttca
gccattccatttaatgaaacaatgaaaatgccaatagagatgagcaaacaccaaattaaa
gatactgtattagcttttcagcaagctgcagtacgatccaaacaagctggatttgacgtt
attgaaatacacggtgctcacggttatcttattaatgaatttctttctccacttaccaat
aagcggactgatgaatatggtggttcacctgaaaaccgctatcgtttcttacgcgaaatc
attgactccataaatgaagtttggaacggaccgttatttgttcgtatttcagcaaatgat
tatcatcctgacgggttaacagttcaagattatgttcagtatacgaaatggatgaaagaa
caaggagtagatttaatcgattgtagctctggggctgttgtacctgcacgcatcgatgtt
tatcctgggtatcaagtacaatatgctaaacatattaaagaacatgctaacattgcaact
ggtgcagttggattgattacgactggggcacaagcagagcaaattttaaataataacgaa
gcagatttaatttttatcggacgtgagttacttcgcaatccttacttcccacgaatagcc
gccaatgaacttggctttgagttagaagaaccgtatcaatacgagcgagcgcctgggaaa
atcagtacaaataaataa

DBGET integrated database retrieval system