KEGG   Bacillus cereus ATCC 10987: BCE_2604Help
Entry
BCE_2604          CDS       T00162                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family superfamily
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00010  Glycolysis / Gluconeogenesis
bca00071  Fatty acid degradation
bca00350  Tyrosine metabolism
bca00625  Chloroalkane and chloroalkene degradation
bca00626  Naphthalene degradation
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_2604
  Lipid metabolism
   00071 Fatty acid degradation
    BCE_2604
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCE_2604
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCE_2604
   00626 Naphthalene degradation
    BCE_2604
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCE_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AAS41519
UniProt: Q737P3
Position
2480022..2480948
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKRLKWETREIKSIQNDEIIVKTIAGAISIGAELPQYKESDVSDTNPIYP
RKTGYESYGEVIQVGNKVTNLNIGDKVVSFYGHETIGIVKGDKVIRVPSYIKPKVALLSI
LSCDAAKGVLKLNMRQDEKVLITGMGVIGLLACYFLKYYVGVKHVDVVXPNKNRRDFAKN
FGAKNTYESEEQIIETYNYGFECSATNIGFHTLQKALNSNSEICILSDGNLEELTLTADF
YEKELRIIGSSDGYNYQQHADWFFSQIEQTPWIEEIFQHEIQYTGLIQCFEELSQGIITP
LKVFVSYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaacgtcttaagtgggaaacgcgcgaa
attaagtctatacagaatgatgaaattatcgttaaaacaattgcaggtgcaataagtatt
ggagcagagttaccacagtataaagaatcggatgtttcagatacaaatcctatttatcca
agaaaaactggatatgaaagttatggtgaagtgattcaagttggtaataaagtaacgaat
ttaaacataggcgataaagtagtttctttttatggacatgaaacgataggaatagttaag
ggggataaagtaattcgagttcctagttatataaaacctaaagtggcgttattatctatt
ctttcgtgtgatgctgctaaaggagtattaaaactaaatatgcgacaggatgaaaaagta
cttataactggaatgggagttattggtttactcgcttgttattttttaaaatactatgta
ggtgttaagcatgtagatgttgttgamcctaataaaaatagaagagattttgcaaagaat
tttggtgcgaaaaacacatatgaatcagaagaacaaataatagaaacatataattacggt
ttcgaatgttctgctacaaatatcggatttcatacattacaaaaagcacttaacagtaat
agtgaaatatgtatactttctgatgggaatttagaggaactaacattaaccgctgatttt
tatgagaaagaactgcggatcattggttcaagtgacggatataattatcaacaacatgca
gattggttttttagtcaaatagaacaaacaccatggatagaagagatttttcaacatgaa
atacaatatacaggactcattcaatgttttgaggaattaagtcaaggaataattacccct
ttaaaagtatttgtctcatatgaataa

DBGET integrated database retrieval system