KEGG   Bacillus cereus ATCC 10987: BCE_2860Help
Entry
BCE_2860          CDS       T00162                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00010  Glycolysis / Gluconeogenesis
bca00053  Ascorbate and aldarate metabolism
bca00071  Fatty acid degradation
bca00280  Valine, leucine and isoleucine degradation
bca00310  Lysine degradation
bca00330  Arginine and proline metabolism
bca00340  Histidine metabolism
bca00380  Tryptophan metabolism
bca00410  beta-Alanine metabolism
bca00561  Glycerolipid metabolism
bca00620  Pyruvate metabolism
bca00625  Chloroalkane and chloroalkene degradation
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
Module
bca_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_2860 (aldA)
   00053 Ascorbate and aldarate metabolism
    BCE_2860 (aldA)
   00620 Pyruvate metabolism
    BCE_2860 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCE_2860 (aldA)
   00561 Glycerolipid metabolism
    BCE_2860 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCE_2860 (aldA)
   00310 Lysine degradation
    BCE_2860 (aldA)
   00330 Arginine and proline metabolism
    BCE_2860 (aldA)
   00340 Histidine metabolism
    BCE_2860 (aldA)
   00380 Tryptophan metabolism
    BCE_2860 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCE_2860 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCE_2860 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCE_2860 (aldA)
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BCE_2860 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAS41772
UniProt: Q736P0
Structure
PDB: 

Position
complement(2697666..2699150)
Genome map
AA seq 494 aa AA seqDB search
MLTKNIELKPKVKAFLNEEIKMFINGEFVPSISGKTFETYNPATEDVLAVVCEAQEEDIN
VAVKAARSAFESGPWAEMTTAERAHLIYKLADLIEEHGEELAQLEALDNGKPYQVALDDD
IAATVENYRYYAGWATKIIGQTIPISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGA
ALATGCTIVLKPAEQTPLSLLYTAKLFKEAGFPKGVVNFVPGFGPEAGAAIVNHHDIDKV
AFTGSTVTGKYIMRQSAETIKHVTLELGGKSPNIILEDADLEEAINGAFQGIMYNHGQNC
SAGSRVFVHRKHYETVVNELVKMANNVKLGAGMEKETEMGPLVSKKQQERVLHYIEQGKA
EGATVAAGGERAFEKGYFVQPTVFTNVTDDMTIVKEEIFGPVVVVLPFDSTEEVIERANR
SSYGLAAGVWTQNIKTGHQVANKLKAGTVWINDYNLENAAAPFGGFKQSGIGRELGSYAL
DNYTEVKSVWVNIK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgaaaaacattgaactaaaaccaaaagtgaaagcgtttttaaatgaagaaatt
aaaatgtttattaatggtgaatttgttccttccattagcgggaagacatttgagacatac
aatccagcaactgaagatgttttagctgttgtatgcgaagcacaagaagaggatattaat
gtcgcagtaaaagcggcaagatctgcatttgaatcaggaccttgggcagaaatgactact
gctgaaagagcacatcttatttataaattagcagacttaattgaagagcatggagaagaa
ttggcgcagttagaagctttagataacgggaaaccatatcaagtagcactggatgatgat
attgcagcgactgtagaaaattaccgctattatgcgggatgggctacgaaaattatcggg
caaacaattccgatttcaaaagattacttaaattatacacgccatgaacctgttggggtt
gtaggacaaattattccttggaattttccgctcgttatgtcttcttggaaaatgggagct
gcactagcgacaggttgtacgatcgtattaaaaccagcagaacaaacgcctttatcgtta
ttatatacagcgaaactttttaaagaagcaggttttccaaaaggtgttgtaaactttgtg
ccaggtttcggccctgaagcgggagctgcaattgtaaaccatcatgatattgataaggta
gccttcacaggttcaacagttacaggaaaatatattatgcgtcaatctgcagaaactatt
aaacatgtaacgttagaacttggtggtaaatcaccaaatatcattttagaagacgctgat
ttagaagaagcgattaacggcgcattccaaggtattatgtataatcacggccaaaattgt
agtgctggatctcgcgtgttcgttcaccgaaaacattacgaaacagtcgtaaatgaacta
gtaaaaatggcgaataacgtgaaacttggagcaggtatggagaaggaaacagaaatgggt
ccactcgtatctaaaaagcaacaagagcgtgtactacattacattgaacaaggaaaagca
gaaggcgctactgttgctgctggtggtgaacgtgcatttgaaaaaggttattttgtacag
ccaacggtattcacaaatgttactgatgatatgacaattgtgaaagaagaaatttttgga
ccagttgtcgttgtacttccatttgattcaacagaagaggtaatcgaaagagcaaatcgc
tcgtcatacggactcgctgcaggcgtatggacacaaaatattaaaactggacatcaagtt
gccaataaattaaaggcaggaacagtatggattaatgattataacttagaaaatgcagct
gcaccatttggtgggtttaaacaatctggaatcggtcgtgagttaggttcatatgcgctt
gataattacacagaagtgaagagtgtttgggtaaatataaagtaa

DBGET integrated database retrieval system