KEGG   Bacillus cereus ATCC 10987: BCE_3862Help
Entry
BCE_3862          CDS       T00162                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00900  Terpenoid backbone biosynthesis
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01130  Biosynthesis of antibiotics
Module
bca_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCE_3862 (dxr)
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BCE_3862 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAS42767
UniProt: Q732P8
Position
complement(3612297..3613439)
Genome map
AA seq 380 aa AA seqDB search
MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREE
DVLKLQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIAN
KETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKT
RDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKES
IIHSMVEFEDRSVMAQLGSPDMRVPIQYALTYPDRLPLSDTKQLNLWEMGTLHFEKMNQE
RFRCLRFAYEAGKTGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARP
SLEEILEIDATTRRFVMEQI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattagtttattaggtgcaagcggatcaattggtacacaaactttagatgta
ttacgctcgcacccagaccaattccgtctcgttgctttttctgtagggaaaaatattgac
tacgcagtaaaagtcattcaagaattttctccgcaaattgtctctgtgcaaagagaggaa
gatgttttaaaattacaagctgtctctggtaatacaaaaattgtatatggtagtgaagga
cttttagaagtagcattacatccagatgcggagatcgtagtaaatgctgttgtaggtagc
gtagggttgttaccaacacttcgtgcaattgaggcgaaaaaaacaattggaattgcaaac
aaagaaacgttagtaactgcagggcatcttgtaatggaagcagcgcgaaaacataatgtt
tcgttacttccagtagacagtgaacattcagctatttttcaatgcttgaatggtgaaaat
gaaaaaagaatttctcgactaattataacggcttctggtggaagtttccgtgataaaacg
agagatgaattgcatcatgtgaccgtagaagatgcgcttcgacatccaaactggtcaatg
ggttcgaaaattacaattgattctgctacaatgatgaataaggggctagaagtaattgaa
gcacattggctttttggtatcccttacgagcaaatcgatgttgttttacataaagaaagt
attattcattctatggttgaatttgaagatcgtagtgtgatggcacagcttggctcacct
gatatgcgagtaccaattcaatacgcacttacatatcctgatcgattgcctctttcagac
acaaagcagttaaatttatgggaaatgggtacattgcattttgagaaaatgaaccaagaa
cgtttccgttgcttgcgctttgcgtatgaagctggaaaaacaggtggaagtatgccggct
gtaatgaatgcagcgaatgaagtagctgttgaagcttttttacaaaagagaattggtttc
ttaacagtggaagacctcattgaaaaagcaatgaaccatcacaatgtcattgcacgtccg
agcttagaggaaattctggaaattgatgcaaccacaagacggtttgtgatggaacaaatt
tag

DBGET integrated database retrieval system