KEGG   Bacillus cereus ATCC 10987: BCE_3931Help
Entry
BCE_3931          CDS       T00162                                 

Gene name
carB
Definition
(GenBank) carbamoyl-phosphate synthase, large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00240  Pyrimidine metabolism
bca00250  Alanine, aspartate and glutamate metabolism
bca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BCE_3931 (carB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCE_3931 (carB)
Enzymes [BR:bca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     BCE_3931 (carB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS Dala_Dala_lig_C ATP-grasp_3 GARS_A ATP-grasp ATPgrasp_Ter ATP-grasp_4 RimK ATP-grasp_5 PrpR_N SinI Toprim_3
Motif
Other DBs
NCBI-ProteinID: AAS42834
UniProt: Q732I3
Position
complement(3680484..3683702)
Genome map
AA seq 1072 aa AA seqDB search
MPKRLDINTILVIGSGPIVIGQAAEFDYSGTQACQSLKEEGYKVILVNSNPATIMTDTAT
ADKVYIEPLTLEFVSRIIRKERPDAILPTLGGQTGLNMAVELAKSGVLEECGVEILGTKL
SAIEQAEDRDLFRTLMQDLNEPTPPSEIIHNLDEAYSFVNEIGYPVIVRPAFTLGGTGGG
ICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVCNMENIDPV
GVHTGDSIVVAPSQTLSDREYQMLRNTSLRIIRALGIEGGCNVQLALDPYSFQYYVIEVN
PRVSRSSALASKATGYPIAKLAAKIAVGLTLDEIVNPVTQKTYACFEPALDYVVSKIPRW
PFDKFESANRTLGTQMKATGEVMSIGRNLEESLLKAVRSLELGIYHLELDHLKELDKETM
KKRIIKADDERLFIVAEAIRQGVTKEEINEWCEMDFFFLQKVENIVNMEREVKANVGNME
VLQTAKEMGFSDHYIAAAWNKTEREIYDMRKENNMTPVFKMVDTCAAEFESATPYYYSTY
AEENESIVTDRKSVVVLGSGPIRIGQGVEFDYATVHSVWAIKEAGYEAIIINNNPETVST
DFSISDKLYFEPLTIEDVMHIIDLEKPEGVIVQFGGQTAINLAAKLEEHGVKILGTSLED
LDRAEDRDKFEAALTKLGIPQPVGKTATTVEQAVAIAEEIGYPVLVRPSYVLGGRAMEIV
YRQEELLHYMKNAVKVHADHPVLIDRYMVGKEIEVDAISDGENVFIPGIMEHIERAGVHS
GDSIGVYPPQSLSEKLKEQIIEHTIALGKGLNIVGLLNIQFVVFENQVYVIEVNPRASRT
VPFLSKITGVPMANVATKVILGQDLVEQGYGTGYHPEEKEVYVKAPVFSFAKLRSVDTTL
GPEMKSTGEVMGKDLTLEKALYKGLVASGINIPTHGSVIITVADKDKEEAMEIAKRFHEI
GYNLLATAGTAQSLTEQNIPVQVVNKIDSEDYNLLDIIRQGKAQFVINTLTKGKQPARDG
FRIRRESVENGVACLTSLDTTRAILRVLESMTFSAHSMKEITQTKRHEVVHA
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacgcctagacattaacacaattttagtaatcggatcaggaccaattgtaatt
gggcaagcagcggagtttgactactctggtacacaagcttgtcaatctcttaaagaggaa
ggttacaaagtaatccttgttaactctaacccagcaacaattatgaccgatactgcaaca
gcagataaagtatacattgagcctttaacattagaattcgtaagccgaatcattcgtaaa
gaacgtccagatgcaatcttaccaacattaggtggtcaaacaggtttaaacatggctgtt
gaacttgcaaaatcaggcgtacttgaagagtgcggagttgaaattttaggaacaaaattg
tcagcaatcgagcaagcggaagatcgtgatttattccgtacattaatgcaagatttaaat
gaaccaacaccaccaagtgaaatcattcataaccttgatgaagcatatagctttgtaaac
gaaattggttatccagtaatcgttcgtccagcattcacattaggcggaacgggcggcgga
atttgccataacgaagaagagttaattgaaatcgtaacaagtggtttaaaacatagccca
gtaacacaatgtttattagagaaaagtattgctggttgtaaagaaattgaatatgaagta
atgcgtgattcaaatgataacgcgattgtagtatgtaacatggaaaacatcgatccagtt
ggtgttcatacaggtgattctatcgttgtagcaccgagccaaacgctaagcgaccgtgaa
taccaaatgttacgtaatacttcattacgaattattcgtgcactaggaattgaaggtgga
tgtaacgttcagcttgcactagatccatatagcttccaatactatgtaatcgaagtaaac
ccacgtgtaagtcgttcatctgcattagcatctaaagcaactggatatccaattgcgaaa
ttagcagcgaaaattgcagtcggcttaacattagatgaaatcgtaaacccagtaacacaa
aaaacttacgcttgcttcgagccagcattagactatgttgtttcaaaaattccacgctgg
ccatttgataagtttgaatcagcgaacagaacacttggaacgcagatgaaagcaactggt
gaggttatgtcaatcggacgtaacttagaagaatcattattaaaagcggttcgttcttta
gagcttggcatttatcacttagaattagaccacttaaaagaacttgataaagaaacaatg
aaaaaacgcattattaaagcagatgatgagcgactgtttatcgtagcagaagcaattcgt
caaggtgtaacgaaagaagagattaacgaatggtgtgaaatggacttcttcttcttacaa
aaagttgaaaatatcgtaaatatggaacgcgaagtaaaagcgaatgtaggaaatatggaa
gtactacaaaccgcaaaagaaatgggcttcagcgatcactacatcgcagcagcttggaac
aaaacggagcgcgaaatttacgatatgcgtaaagaaaataatatgacgccagtattcaaa
atggtagatacttgtgcggcagagtttgaatctgcaacaccgtattactacagcacatac
gctgaggagaacgaatcaattgtaacagatcgtaagagtgtagtagttctaggatctggt
ccgatccgcattggtcaaggtgttgagtttgactatgcaacagttcactcagtatgggca
attaaagaagctggatatgaagcgattatcattaacaataacccagaaactgtttcaaca
gacttcagtatttctgacaaattatactttgaaccattaacgattgaagatgtaatgcac
atcatcgatttagaaaagccagaaggtgttatcgttcagtttggtggacaaacggcgatt
aacttagcggcgaaattagaagaacatggtgtgaagattttaggaacatcacttgaagac
ttagaccgtgcagaagatcgtgataaattcgaagctgctttaacaaaacttggtatccca
caaccagttggtaaaacagcaacgactgtagaacaagcggtagcaatcgcagaagaaatt
ggttacccagtgttagtaagaccatcttacgtactaggtggacgtgcgatggaaatcgta
tatcgtcaagaagaactactgcactacatgaaaaatgcagttaaagttcacgcagatcac
ccagtattaatcgaccgttacatggtcggtaaagaaattgaagtagatgcaatttcagac
ggtgagaatgtattcattccaggtattatggaacatattgaacgcgctggagttcactct
ggtgactcaattggagtatatccaccacaaagcttatctgaaaaattaaaagaacaaatt
attgaacatacaattgcacttggaaaaggattaaacattgttggattactaaatatccag
tttgtcgtattcgaaaatcaagtgtacgtaattgaagtaaatccacgtgcgagccgtaca
gtaccattcttaagtaaaattacaggtgtaccaatggcaaacgttgcaacgaaagttatt
ctagggcaagacctagtagagcaaggatacggaacgggttatcacccagaagagaaagaa
gtatatgtaaaagctccggtattctcattcgcgaaattacgctcagtggatacaacatta
ggacctgaaatgaaatcaacaggggaagtaatgggtaaagatttaacgcttgaaaaagca
ttatataaaggattagttgcttctggaattaacatcccaacgcacggatcagtaatcatt
actgtagcggataaagataaagaagaggcgatggaaattgcaaaacgtttccatgaaatc
ggctataacttattagcaacagctggaacagcacaatcgttaacagagcaaaatatccca
gtacaagttgtaaacaaaattgattctgaggactacaacttactagatattatccgccaa
ggaaaagcacagtttgtaatcaatacattaacaaaaggcaaacaaccagcgcgtgatggt
ttccgcattcgccgtgaatcagtagaaaatggtgtagcttgcttaacatcacttgataca
acgagagcaatcttacgagtattagaatctatgacattctcagctcattcaatgaaagaa
attacgcaaacaaagcgtcacgaggtggtacatgcatga

DBGET integrated database retrieval system