KEGG   Bacillus cereus ATCC 10987: BCE_4076Help
Entry
BCE_4076          CDS       T00162                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00071  Fatty acid degradation
bca00072  Synthesis and degradation of ketone bodies
bca00280  Valine, leucine and isoleucine degradation
bca00310  Lysine degradation
bca00362  Benzoate degradation
bca00380  Tryptophan metabolism
bca00620  Pyruvate metabolism
bca00630  Glyoxylate and dicarboxylate metabolism
bca00640  Propanoate metabolism
bca00650  Butanoate metabolism
bca00900  Terpenoid backbone biosynthesis
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01200  Carbon metabolism
bca01212  Fatty acid metabolism
bca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCE_4076
   00630 Glyoxylate and dicarboxylate metabolism
    BCE_4076
   00640 Propanoate metabolism
    BCE_4076
   00650 Butanoate metabolism
    BCE_4076
  Lipid metabolism
   00071 Fatty acid degradation
    BCE_4076
   00072 Synthesis and degradation of ketone bodies
    BCE_4076
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCE_4076
   00310 Lysine degradation
    BCE_4076
   00380 Tryptophan metabolism
    BCE_4076
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCE_4076
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCE_4076
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCE_4076
Enzymes [BR:bca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCE_4076
Exosome [BR:bca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCE_4076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAS42978
UniProt: Q731T9
Position
complement(3813920..3815095)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagttgatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgtcgttgcaggtggagtagaagcaatgagttca
agcccttatgcattgaaacaacaccgctggggacaacgtctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcgctaaaggcaattgagtctggatactttgacgatcaaattgttcct
attacgataaaagaacgtagaaaagaagtagtattttcaaaagatgaacatccacgtgct
gatattacagcagaaaaattagctggattaaaaccagctttccgtaaagacggttcagta
actgcagggaatgcatctggcctgaatgacggaagcgcggttttagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttgggtattcagtagct
ggagtagatccgaaaattatgggtattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgcg
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaacggt
agtggtgtaggacttggacatccaatcggttgtacaggagctcgtattactgtaagctta
attcatgaattaaagagacgcggattagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggagtagcattatttatagaagcactataa

DBGET integrated database retrieval system