KEGG   Bacillus cereus ATCC 10987: BCE_4104
Entry
BCE_4104          CDS       T00162                                 

Definition
(GenBank) hydrolase, haloacid dehalogenase-like family
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00270  Cysteine and methionine metabolism
bca01100  Metabolic pathways
Module
bca_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BCE_4104
Enzymes [BR:bca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     BCE_4104
SSDB
Motif
Pfam: HAD UMPH-1 Put_Phosphatase Hydrolase HAD_2
Other DBs
NCBI-ProteinID: AAS43006
UniProt: Q731R1
Position
3837458..3838117
AA seq 219 aa
MSIQVFCDFDGTITNNDNIMSIMEKFAPPEAEEVKNRILSQELSIQEGVSQLFQFIPTNL
HDEIIQFLIETAEIRNGFHEFIQFVNKNNISFYVISGGMDFFVYPLLQGLIPKEQIYCNE
TDFSNEYITVNWPHPCDHHCQNHCGLCKSSLIRKLSNTNDFHIVIGDSITDLQAAKQADK
VFARDFLITKCEENHISYTPFESFHDIQNELKHLLEVKL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagtattcaagtattttgtgatttcgatggcacgattacaaataatgataacattatg
tccattatggaaaaatttgcaccaccagaagctgaagaagtaaagaatagaattttatca
caagagctatctattcaagaaggtgtttctcaattatttcaattcatacctactaatctg
cacgatgaaattattcaatttttaatagagactgctgaaatccgtaatggttttcatgaa
tttatacaatttgtaaataaaaataatatttccttttatgttatatcaggtggaatggat
ttcttcgtctatccactcttacaaggactcattccgaaagagcaaatttactgtaatgaa
acagatttttcaaatgaatacattacggtgaattggcctcatccttgtgatcatcattgt
caaaatcattgcggattatgtaaatcatcactcatccgtaaattaagtaatacaaatgac
ttccatattgtaatcggagattcaattactgatttacaagctgcgaaacaagcggataaa
gtgttcgctcgtgacttccttattacaaaatgtgaagaaaatcatatttcttatacacca
tttgaatcgtttcacgatattcaaaacgaattaaaacatttgttggaggtgaaattatga

DBGET integrated database retrieval system