KEGG   Bacillus cereus ATCC 10987: BCE_4781Help
Entry
BCE_4781          CDS       T00162                                 

Definition
(GenBank) acetyl-CoA synthetase, putative
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00010  Glycolysis / Gluconeogenesis
bca00620  Pyruvate metabolism
bca00640  Propanoate metabolism
bca00680  Methane metabolism
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_4781
   00620 Pyruvate metabolism
    BCE_4781
   00640 Propanoate metabolism
    BCE_4781
  Energy metabolism
   00680 Methane metabolism
    BCE_4781
Enzymes [BR:bca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCE_4781
Lipid biosynthesis proteins [BR:bca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCE_4781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAS43682
UniProt: Q72Z88
Position
complement(4425266..4426834)
Genome map
AA seq 522 aa AA seqDB search
MAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIKSGLQKG
DKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSYEPYIGQ
FDDIEAMDSLQKFVLSEQSVDGWINLKTALEKESDMLEMAKTDKEDMVFLSYTSGTTGNP
KGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGATGFVYH
GKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPLNREVIE
TFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVNEEGVPVKVGEV
GDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDDIIISSG
YTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIPILQQHV
KELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttggcaccgccgtcttataatttagtttctgaaatagagaaatatacaggtgataaagag
aagcttgctttaatttggcaagatgataaagggaatcgacgagaagttacatacgctgag
ttaatgaaaggtgcaaataaaattggaaacgcttttataaagagtggtctgcaaaaaggg
gacaagctcctcattatgatgcctcgtttaattgaagcgtacatgacgtatatcgctgcg
attaaagcaggatttgtcgtaattccgagttcagaaatgttacgtaaaaaggatatcgaa
taccgcattggacacggggaagtaaaagcaatcgtaagttatgagccctatattggacag
tttgatgatatagaagcgatggattctcttcaaaaattcgttctgagcgagcagtcagta
gatggatggattaacttaaaaacagcgttagaaaaagagagtgatatgttagaaatggcg
aagacagataaagaagatatggtctttttatcttacacgtcaggaacgacaggaaatcca
aaaggtgttgtgcatacgcatgcgtgggcatacgctcatttacgtacgagcgctccaaat
tggctcggaattgaagagaatgatgttgtatgggcgacggctagtccaggctggcaaaag
tggatttggagcccgtttttagcaactctaggctcaggggcaacaggatttgtataccac
ggtaagtttgaaccgaaaacgtatttaaatttattagacgataataaggtgaatgtgctt
tgttgtacgccgactgagtatagattaatggcaaaggtagaaaatttaagcgagtacaat
ttagaagcgttacatagcgctgtatccgcaggtgagccgttaaatagagaagtcattgaa
acgttccaaaagcactttcatattacagtaagagacggctatgggcaaacggaaaataca
ttgcttgttggtgtaatgaaagggatggatattagaccaggatcaatgggaaaaccaacg
ccaggcaaccacgttgatatcgtaaatgaggaaggtgttccggttaaagtaggcgaggtt
ggtgatattgcagttcacattgaaacgccagccctctttaaacaatattacaaagacgat
gagcgcacagcgatgcaattccgcggtgattattatattactggtgataaagcgaagaaa
gatgaagacggctatttctggtttgaagggcgcggtgatgatattattattagctctggt
tatacaatcgggccgtttgaagtagaagatgcacttgtaaaacatccttacgtaagagaa
tgtgcagttgtcgcaagccctgatgaaattcgcggaagtgtcgtgaaggcatttatcgta
ttaagagagaatatagaaaagaacgaagaaacattaattccaatactccaacaacacgtc
aaagaacttactgcaccatataaataccctcgcaaaattgaatttgtagatgaactacca
aaaacgatttccggaaaaattcgccgtattgaacttagaaaacaagagatggagattccg
tcaaaataa

DBGET integrated database retrieval system