KEGG   Bacillus cereus ATCC 10987: BCE_5475Help
Entry
BCE_5475          CDS       T00162                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00071  Fatty acid degradation
bca00072  Synthesis and degradation of ketone bodies
bca00280  Valine, leucine and isoleucine degradation
bca00310  Lysine degradation
bca00362  Benzoate degradation
bca00380  Tryptophan metabolism
bca00620  Pyruvate metabolism
bca00630  Glyoxylate and dicarboxylate metabolism
bca00640  Propanoate metabolism
bca00650  Butanoate metabolism
bca00900  Terpenoid backbone biosynthesis
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01200  Carbon metabolism
bca01212  Fatty acid metabolism
bca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCE_5475
   00630 Glyoxylate and dicarboxylate metabolism
    BCE_5475
   00640 Propanoate metabolism
    BCE_5475
   00650 Butanoate metabolism
    BCE_5475
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCE_5475
   00072 Synthesis and degradation of ketone bodies
    BCE_5475
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCE_5475
   00310 Lysine degradation
    BCE_5475
   00380 Tryptophan metabolism
    BCE_5475
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCE_5475
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCE_5475
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCE_5475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bca04147]
    BCE_5475
Enzymes [BR:bca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCE_5475
Exosome [BR:bca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCE_5475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AAS44375
UniProt: Q72XA3
Position
complement(5051537..5052718)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVVDLNIADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHNEGRFEEEIVPVTIPQRKGDPIVVAKDEAPRADTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKTIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccggttgggaaatttggagggtct
ttaaaagatgtaaaagcaacagaacttggagggattgcaattaaagcggcgcttgaaaga
gcaaatgtttctgctagtgatgttgaggaagttatattcggaacggttattcaaggtgga
cagggacaaattccatcacgccaagcggcgagggctgctggaatcccttgggaagtgcag
acggaaacagtgaataaagtttgtgcgtcggggcttcgtgcggttacgttagcggatcaa
attattcgtactggcgatcaatcattgattgtagctggtggtatggagtcgatgagtaac
agtccttacattttacgaggagcaagatggggatacagaatgggcaacaacgaagtcgtt
gatttaaacattgctgacggtttaacatgcgcattttctggtatacacatgggtgtttat
ggcggagaagttgcgaaggaagatggaatttctcgcgaagcgcaagatgaatgggcatat
cgtagccaccaacgtgcggtttcagcacataatgaaggacgttttgaagaggaaatcgtg
ccagtaacgattccgcaaagaaaaggcgatcctattgtcgttgcaaaggatgaggcgcca
cgcgcggatacaacaattgaaaagttagcaaaattaaaacctgtatttgataaaacagcg
acagtgacagctggtaatgcaccaggcttaaacgatggtggtgctgcacttgtattaatg
agcgaagacagagcgaagcaagaaggaagaaagccgttagcgacaattttggcacataca
gcaattgcagtggagtctaaagatttcccgagaacgccaggttatgcaattaacgcattg
cttgaaaaaacaggaaagacaattgaagacatcgatttattcgagattaatgaagcattt
gcagcagtagcaattgcaagtacagagattgcgggaattgatccagaaaaattgaatgta
aatggcggcgcagtggcgatggggcatccgattggagcaagcggagcgcgcattatcgtt
acactaatccatgcactgaagcaacgcggcggcggaattggaattgcttcgatttgtagc
ggtggtggtcaaggtgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system