KEGG   Bacteroides caccae: CGC64_15525Help
Entry
CGC64_15525       CDS       T05064                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bcac  Bacteroides caccae
Pathway
bcac00780  Biotin metabolism
bcac01100  Metabolic pathways
Module
bcac_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bcac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CGC64_15525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcac01007]
    CGC64_15525
Enzymes [BR:bcac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CGC64_15525
Amino acid related enzymes [BR:bcac01007]
 Aminotransferase (transaminase)
  Class II
   CGC64_15525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ASM67211
UniProt: A0A174TZQ5
Position
3757827..3758981
Genome map
AA seq 384 aa AA seqDB search
MISDHINQELLTLKEKKNYRSLPPLIHDGRNVILNGQRMVNLSSNDYLGLANNISLRKEF
LKTITPETFLPTSSSSRLLTGNFTDYQELEQQLAAMFGTESALIFNSGYHANTGILPAVS
NAQTLILADKLVHASLIDGIRLSSAKCIRYRHNDLSQLQRLISENHNAYEQIIIVTESIF
SMDGDEADLHALVQLKKSYSNILLYVDEAHAFGVRGDNGLGCAEEQNCINDIDFLVGTFG
KAIASAGAYIACRQVIREYLINKMRTFIFTTALPPINIQWTSWILEQLPSLQEKRTHLLR
ISNKLKTALVDKGYNCPSVSHIVPMIVGASENTICKAEEIQRKGFYALPVRPPTVPEGTS
RIRFSLTADITEHEIDQLIKLING
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatatcagaccatataaaccaagaacttcttactctaaaggaaaagaagaattatcgc
tctctcccacccctcatccacgacgggcggaatgtaattctgaacgggcaacggatggtg
aacctgtcttccaatgattatctcggactggctaataacatatcgctgagaaaggaattc
ctaaagacaataactcctgaaacattcctgcctacctcttcttcttcccgattgcttaca
ggcaattttaccgattatcaagaactggaacaacaactggcagccatgttcggaacagaa
agcgcacttatattcaatagtggttatcatgccaatacagggattcttcctgccgtcagc
aatgctcagacattaattcttgcagacaaactggtacacgccagtttgatagacggaatc
aggttgtcatctgcgaaatgtatccggtatcgccataatgacttatcccagttacagcga
ttgatttccgagaatcacaatgcgtatgagcaaatcattattgtcaccgaaagtatcttc
agcatggacggtgatgaagccgaccttcatgcccttgtccaattaaaaaaaagttattcc
aatattcttctttacgtggacgaagcccatgctttcggtgtacggggagacaacggatta
ggatgtgctgaagaacaaaattgcatcaacgatatagactttctggtaggaacattcggg
aaagcaatagcctcagcaggagcttacattgcctgccgacaagttatccgggaatatcta
atcaacaagatgcgcacgtttatattcacaacagcccttccacccataaatattcaatgg
acctcgtggatactagaacaactaccctctctccaagagaaaaggacacatttgttacgg
atcagcaacaaactaaagactgcacttgtcgacaaaggatataactgtccttcggtaagc
catattgtccctatgattgtaggggcaagtgaaaacactatatgtaaagcagaagaaatc
caacgcaaaggattctatgcattgccggtacgtccgcctacggttcctgaagggacttca
cgcatccgcttctcattaacagcggacatcaccgaacacgaaatcgaccaacttataaaa
ttgataaacggatga

DBGET integrated database retrieval system