KEGG   Paraburkholderia caribensis: K788_0002436Help
Entry
K788_0002436      CDS       T04141                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase/Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00071  Fatty acid degradation
bcai00072  Synthesis and degradation of ketone bodies
bcai00280  Valine, leucine and isoleucine degradation
bcai00310  Lysine degradation
bcai00362  Benzoate degradation
bcai00380  Tryptophan metabolism
bcai00620  Pyruvate metabolism
bcai00630  Glyoxylate and dicarboxylate metabolism
bcai00640  Propanoate metabolism
bcai00650  Butanoate metabolism
bcai00900  Terpenoid backbone biosynthesis
bcai01100  Metabolic pathways
bcai01110  Biosynthesis of secondary metabolites
bcai01120  Microbial metabolism in diverse environments
bcai01130  Biosynthesis of antibiotics
bcai01200  Carbon metabolism
bcai01212  Fatty acid metabolism
bcai02020  Two-component system
Module
bcai_M00088  Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K788_0002436
   00630 Glyoxylate and dicarboxylate metabolism
    K788_0002436
   00640 Propanoate metabolism
    K788_0002436
   00650 Butanoate metabolism
    K788_0002436
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K788_0002436
   00072 Synthesis and degradation of ketone bodies
    K788_0002436
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K788_0002436
   00310 Lysine degradation
    K788_0002436
   00380 Tryptophan metabolism
    K788_0002436
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K788_0002436
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K788_0002436
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K788_0002436
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcai04147]
    K788_0002436
Enzymes [BR:bcai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K788_0002436
Exosome [BR:bcai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K788_0002436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALL64932
UniProt: A0A0P0R9A8
Position
1:complement(2266860..2268182)
Genome map
AA seq 440 aa AA seqDB search
MPDPSHPPSHPLPAARRVAILGGNRIPFARSNTAYATASNQDMLTFALQGLIDRYNLHGE
RLGEVAAGAVIKHSRDYNLTREAVLSTTLARETPAYDVQQACGTGLEAAILVANKIALGQ
IEAGIAGGADTTSDAPIGVNERLRKILLEANRGKSAGQRVGALAKLRPGMFFKPLLPRNS
EPRTGLSMGEHCELMAKRWGISREAQDVLAYDSHRKLTEAYARGFLNDLMTPFRGLARDN
NLRSDLTLDKLAALKPVFDRDAGTMTAGNSTPLTDGASAVLLASEAWAAARGLPVLAWLS
WHETAAVDFFDKKEGLLMAPAYAVPRMLKRAGLTLQDFDFYEIHEAFAAQVLCTLAAWQD
DEYCRTQLGLEGALGTIDRAKMNVNGGSLATGHPFAATGGRIVAGLAKLLAQLDRPAGTA
RGLISICAAGGQGVVAILER
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacccgtcacatccgccatcccacccgcttcccgccgcgcgccgcgtcgcgata
ctgggcggcaaccgcatcccgttcgcgcgctcgaacacggcctacgcgacggcgtcgaac
caggacatgctgactttcgcgctgcaaggtctgatcgaccgttacaacctgcatggcgag
cgcctcggcgaagtcgcggcgggcgccgtcatcaagcattcgcgcgactacaacctgacg
cgcgaagccgtgctgtcgaccacactcgcaagggaaacgcccgcctacgacgtgcagcag
gcatgcggcacgggcctcgaagcggcgattctggtggccaacaagatcgcgctcggccag
atcgaagcgggcattgcgggcggcgccgatacgacctcggacgcgcccatcggcgtcaac
gaacggctgcgcaaaatcctgctcgaagcgaaccgcggcaagtcggcggggcagcgcgtc
ggcgcgctcgccaagctgcgccccggcatgttcttcaaaccgcttttgccgcgcaacagc
gagccgcgcacggggctgtcgatgggcgagcactgcgagctgatggccaagcgctggggc
atttcgcgcgaggcacaagacgtgctcgcctacgatagccaccgcaagctgacggaagcc
tacgcgcgcggctttctgaacgacctgatgacgccctttcgcggtctcgcacgcgacaac
aacctgcgcagcgacctgacgctggacaagctggccgcgttgaaacccgtgttcgaccgc
gacgcgggcacgatgacggcgggcaactcgacgccgctgacggacggcgcatcggccgtg
ctgctcgccagcgaggcatgggcggcggcgcgcggccttcccgtgctggcgtggctcagc
tggcacgagacggccgccgtcgatttcttcgacaagaaagaaggcttgctgatggcgcct
gcgtacgccgtgccgcgcatgttgaaacgcgcaggcctgacgttgcaggatttcgacttc
tacgaaattcacgaggcgttcgcggcgcaggtgctctgcacgctcgccgcctggcaggac
gatgagtactgccgcacgcaactgggactcgaaggcgcgctgggaaccatcgatcgcgcg
aaaatgaacgtgaacggcggatcgctcgcgacgggccatccgttcgccgccacgggcgga
cgcatcgtcgccggactcgcgaagctgctcgcgcagctcgacaggccggcgggcacggcg
cgcgggctgatttcgatctgcgcggcgggcggccagggtgtggtcgcgattctggaacgg
tag

DBGET integrated database retrieval system