KEGG   Paraburkholderia caribensis: K788_0003418Help
Entry
K788_0003418      CDS       T04141                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00670  One carbon pool by folate
bcai00790  Folate biosynthesis
bcai01100  Metabolic pathways
Module
bcai_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    K788_0003418
   00670 One carbon pool by folate
    K788_0003418
Enzymes [BR:bcai01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     K788_0003418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ALL65996
UniProt: A0A0P0RCF5
Position
1:3402980..3403480
Genome map
AA seq 166 aa AA seqDB search
MTTLTLIVARARNGVIGRDNQLPWRLPEDLAFFKRTTMGAPIVMGRKTHESIGRVLPGRR
NIVVTRDAQRRFDGCDTVTNLDDALALAARDGAAEAFLIGGAQLYQEGALRADKMIVTEI
HAEFDGDARFPAPDPAIWREISRETHWAKEPNDFEYAFVVYQRVAR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgacgctgatcgtcgctcgcgcccgcaatggcgtgatcggccgtgataac
cagttgccctggcggctgcccgaagacctcgcattcttcaaacgcacgacgatgggcgcg
cccattgtcatggggcgcaagacgcatgaatcgattgggcgggtgttgcctgggcggcgc
aatatcgtcgtgacgcgcgatgctcagcgacgcttcgacgggtgcgataccgtgaccaat
ctcgatgatgcgttggcgctcgcggcgcgcgatggggccgccgaggcgtttttgatcggc
ggtgcgcagttgtatcaggaaggtgcgcttcgcgcggataagatgatcgttactgaaatt
catgccgaatttgacggcgatgcgaggtttcctgcgcctgatccggcgatttggcgtgag
atttctcgcgagacgcattgggctaaagagccgaatgattttgaatatgcgtttgtggtt
tatcaacgcgtagcgcggtag

DBGET integrated database retrieval system