KEGG   Paraburkholderia caribensis: K788_0004352Help
Entry
K788_0004352      CDS       T04141                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00053  Ascorbate and aldarate metabolism
bcai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    K788_0004352
Enzymes [BR:bcai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     K788_0004352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 RmlD_sub_bind Polysacc_synt_2 KR NmrA adh_short
Motif
Other DBs
NCBI-ProteinID: ALL70674
UniProt: A0A0P0RNZ0
Position
unnamed:1355484..1356317
Genome map
AA seq 277 aa AA seqDB search
MNETSAGSRKPFRRLLLTGAGGNLGRQLRDALAAWADIVRVSDIAPMSAAAAHEEASVVD
LADRDAVMRMVEGVDAIVHLGGISIDAPFDDLIEANIRGTYNLYEAARKHGVKRVVFASS
NHAIGFHPVTEVLDADAPQRPDSLYGVTKCFGESLSRYYFDRFGIETVCLRIGSSFEEPK
NPRMLVTYLSYRDFIELVRCSLFTNRVGHAVVYGASDNPIKWWDNTKANFLGFRPRDSST
QFSDRFPVTSPTAEYDDPAQRFQGGAFVLGEPMERSA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacatctgctgggtcgcgcaagccgttccgccgcctgctgctgacgggcgcg
ggcggcaatctgggccgccagttgcgcgatgcgctggccgcctgggccgacatcgtgcgc
gtgagcgacatcgcccccatgagcgccgcagctgcgcacgaggaagcgagcgtcgtcgat
ctggcggaccgcgacgccgtgatgcgcatggtcgaaggcgtcgatgcgatcgtgcacctg
ggcggcatttcaatcgacgcgccattcgacgacctgatcgaagcgaacatccgcggcacg
tacaacctgtacgaagccgcccgcaaacatggcgtgaagcgcgtcgtgttcgccagttcg
aatcacgcaatcggttttcaccccgtcaccgaagtgctcgacgccgacgcgccgcagcgt
cccgacagcctgtacggcgtgacgaagtgcttcggcgaatcgctgtcgcgctactacttc
gaccgcttcggcatcgagaccgtgtgcctgcgcatcggctcgtcgttcgaagaaccgaag
aatccgcgcatgctcgtcacgtacctgagctatcgcgacttcatcgaactcgtgcgctgc
tcgctgttcacgaaccgtgtcggccacgccgtggtgtatggcgcgtcggacaaccccatc
aagtggtgggacaacacgaaggcgaattttctcggcttccgtccgcgcgacagctccacg
cagttctcggaccgcttccccgtcacgtcgccgacagcggaatacgacgacccggcgcaa
cgcttccagggcggcgcgttcgtgctcggcgaaccgatggaacgcagcgcctga

DBGET integrated database retrieval system