KEGG   Paraburkholderia caribensis: K788_0005680Help
Entry
K788_0005680      CDS       T04141                                 

Definition
(GenBank) putative sugar ABC transport system, ATP-binding protein YtfR
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    K788_0005680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcai02000]
    K788_0005680
Enzymes [BR:bcai01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     K788_0005680
Transporters [BR:bcai02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    K788_0005680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_30 Zeta_toxin AAA_29 SbcCD_C AAA_22 MMR_HSR1 AAA_16 AAA_23 FeoB_N
Motif
Other DBs
NCBI-ProteinID: ALL66525
UniProt: A0A0N7JUI7
Position
2:complement(383963..385477)
Genome map
AA seq 504 aa AA seqDB search
MAAQPLFETIGISKTFPGVKALSGVDFRLFPGEIHSLMGQNGAGKSTLINVLTGVHEQDA
GEIRLAGETVRFATPLEAEAAGIQTLYQEINLCPNLSVAENIFAGRQPKRRGAIDWKTIH
LRAEEALAELNVSLDVTKSLDAYPIAVQQMVAIARAMSVKARVLILDEPTSSLDDGEVAR
LFDVLRNIRQAGIAILFVTHFLEQTYAISDRITVMRNGEREGEYLAKDLPVEQLVAKMVG
HNRMTERLKGGAPDTPQQRAGAAPFLSMQGVARRGVMNPIDLDVQPGQILGLAGLLGSGR
TETARLLFGVDKADAGTISVDGKNVKLSSPHDAVRHGIGYCPEDRKKEGIVAALSIRENI
ILALQARRGWLRVIGRKKQREIADTYIERLGIKAHDAEQPIGLLSGGNQQKVVLARWLAT
EPKMLILDEPTRGIDVAAKFEIMDRVLALCARGLAILFISSEVGEVVRVSHRIAVLRDRR
KIADVTGSAVSEDQVYRLIAGGSE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggccgcacaaccgttattcgaaaccatcggcatcagcaagacgtttcccggcgtgaag
gcgctgtcgggcgtcgacttccggctttttcccggcgaaatccattcgttgatgggccag
aacggcgcgggcaaatccacgctcatcaatgtgctcacgggcgtgcacgagcaggacgcg
ggtgaaatccgcctcgcgggcgaaaccgtgcgtttcgccacaccgctcgaagccgaagcc
gcgggcatccagacgctgtatcaggaaatcaatctctgcccgaatctctccgtggcggag
aacatcttcgcgggccggcaaccgaagcggcgcggcgcgatcgactggaaaacgatccac
ctgcgcgccgaggaggcgcttgccgaactgaacgtgtcgctcgacgtcacgaagtcgctc
gatgcgtatccgatcgccgtgcagcagatggtcgcgattgcacgcgcgatgtcggtgaag
gcgcgcgtgctgattctcgacgaaccgacttcgagcctcgacgacggcgaagtcgcgcgg
ctcttcgacgtgctgcgcaatatccggcaggcgggcatcgcgatcctgttcgtcacgcac
tttctcgagcagacgtacgcgatttcagaccgcatcaccgtgatgcgcaacggtgaacgc
gagggtgaatatctcgcgaaagatctgcccgtcgaacagcttgtcgcgaagatggtcggc
cataaccggatgacggaacgcctcaaaggcggcgcgcccgacacgccgcagcagcgcgcg
ggcgccgcgccgtttctgtcgatgcaaggcgtcgcgcggcgcggcgtgatgaatcccatc
gatctcgacgtgcagccgggccagatactcgggctcgcgggattgctcggttcggggcgc
acagaaaccgcgcgcctgctgttcggcgtcgacaaggccgacgcgggcacgatcagcgtc
gacggcaagaacgtgaagctcagttcgccgcacgatgcggtgcggcacggcatcggctat
tgcccggaagaccgcaagaaggagggcatcgtcgccgcgctgtcgatccgcgagaacatc
atcctcgcgctgcaggcgcggcgcggctggctgcgcgtgatcggccgcaagaagcagcgc
gaaatcgccgacacgtatatcgaacgcctcggcatcaaggcgcacgacgccgagcagccc
atcgggctgctgtcgggcggcaatcagcaaaaggtcgtgctcgcgcgctggctcgccacc
gaaccgaagatgctgattctcgacgaacctacgcgcggcatcgacgtcgccgccaagttc
gaaatcatggaccgcgtgctcgcgctatgcgcacgaggtctcgcgatcctgttcatttcg
tccgaagtcggcgaggtggtgcgcgtgagccatcgcatcgccgtgctgcgcgaccgtcgc
aagatcgccgacgtgacgggcagcgcggtatccgaagatcaggtctaccggctgatcgca
ggggggagcgaatga

DBGET integrated database retrieval system