KEGG   Paraburkholderia caribensis: K788_0005762Help
Entry
K788_0005762      CDS       T04141                                 

Definition
(GenBank) Phospholipase C 4 precursor
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00562  Inositol phosphate metabolism
bcai00564  Glycerophospholipid metabolism
bcai01100  Metabolic pathways
bcai01110  Biosynthesis of secondary metabolites
bcai02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    K788_0005762
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    K788_0005762
   00565 Ether lipid metabolism
    K788_0005762
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    K788_0005762
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bcai02042]
    K788_0005762
Enzymes [BR:bcai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     K788_0005762
Bacterial toxins [BR:bcai02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   K788_0005762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: ALL66612
UniProt: A0A0P0RDX5
Position
2:complement(465854..468007)
Genome map
AA seq 717 aa AA seqDB search
MTSNSRRRFLKTAATSAGAAAAVTMLPESIRNALAVPANSRTGSIRDVEHIVVFMQENRS
FDHYFGHMRGVRGYNDRFPIPLPNGKPVWYQPSKADPTRPVLPFHLNTQTTSAQCVGDLD
HSWYKTHGAIDGGRYDQWPANKTDMTMGYHLRSDIPFHYALADAFTICDAYFCSLPGPTH
PNRSYLMTGTVDPTGTKGGPLLDNNDFVDGDVPPKYQLLSWTTYPERLEAAGISWQIYQQ
GTDGSDPLNGNYGTNILQNFESFINAQPGSSLFQRAQTVRTIDDLKADVQANRLPQVSWL
CPPAAYSEHPKYTPAYGAEYTSQILDALTSNPEVWSKTVLFIMYDENDGFFDHVVPPQVA
TSRAQGLSTVTADGEIHDVVNPGRGGSYTADNLPYGLGPRVPMTIVSPWTKGGFVCSQVF
DHTSVIRFIETRFGVHEPNITAWRRAVCGDLTTAFDFRTPDAKMPPLPDTSNYKSMADNQ
CATQPAPTVPAVPGAIDPQEAGIRFARALPYELHVNGKVDEKANSLTIEIGNTGDQGAHF
YVYATNRTDGPWRYTVEAGKTLKDVFNLASTNGVYAFTVYGPNGFVRRFTGNAQPQSNQA
SAQGGFGHNRKPALPEVKTHYDVGNGNVYLKFTNHGDSIARLSVVDNAYGAHPRPVIVPP
NGSIEEAWVLSASHHWYDLTVSDNDDASFQRRVAGHVETGKTSISDPAAVVPVMAAS
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacatccaatagccgtcgccgttttctaaaaaccgccgcaacgtccgctggcgccgct
gccgccgtgacgatgctgccggaatcgatccgcaatgcgcttgccgtccccgccaattcg
cgcacgggctcgatccgtgacgtcgagcacattgtcgtgttcatgcaggagaaccgttcg
ttcgatcattatttcgggcacatgcgcggcgtgcgcggctacaacgaccgcttcccgatt
ccgctgcccaacggcaagcccgtctggtatcagccgtcgaaggccgatccgaccaggccc
gtgctgccgttccacctgaacacgcagaccaccagcgcgcaatgcgtcggcgatctggat
cactcgtggtacaagacgcacggcgcgatcgacggcggccgctacgaccagtggcccgcg
aacaagacggacatgacgatgggctatcacctgcgctcggacattccgttccactatgcg
ctggccgatgcgttcacgatctgcgacgcgtacttctgttcgctgccgggaccgactcac
ccgaaccgctcgtacctgatgacgggcacagtcgacccgacgggcacgaagggcggcccg
ctgctcgacaacaacgatttcgtcgatggcgacgtgccgccgaagtatcagctgctgtcg
tggacgacctacccggagcgtctggaagcggcgggcatctcgtggcagatctatcagcag
ggcacggacggctcggacccgctgaacggcaactacggcacgaacatcctgcagaacttc
gagagcttcatcaacgcgcagccgggctcgtcgctgttccagcgcgcgcagacggtacgc
acgatcgacgacctgaaggccgacgtgcaggccaaccgcctgccgcaagtgtcgtggctg
tgcccgcccgccgcgtactcggagcacccgaagtacacgcccgcgtacggcgcggagtac
acgtcgcagattctcgacgcgctgacgtcgaaccccgaggtgtggagcaagacggtgctc
ttcatcatgtatgacgagaacgacggtttcttcgatcacgtcgtgccgccgcaagtggcg
acgtcgcgcgcgcaggggctgtcgacggtgacggcggacggcgagattcacgacgttgtc
aatccgggccgcggcggcagctatacggccgacaacctgccatacggtctcgggccgcgc
gtgccgatgacgatcgtctcgccgtggacgaagggcggcttcgtgtgctcgcaggtgttc
gatcatacgtcggtgatccgcttcatcgaaacgcgcttcggcgtgcatgagccgaacatc
acggcatggcgccgcgcggtgtgcggcgacctcacgacggcattcgatttccgcacgccg
gacgcgaaaatgccgccgctgccggacacgagcaactacaagagcatggccgacaaccag
tgcgcgacgcagcccgcgccgaccgtgcctgccgtgccgggtgcaatcgatccgcaggaa
gcgggcattcgtttcgcgcgtgccttgccgtatgagttgcacgtgaacggcaaggtcgac
gagaaggccaattcgctgacgatcgaaatcggcaatacgggcgatcagggcgcgcacttc
tatgtgtatgcgaccaaccgcacggatggtccgtggcgctatacggtggaagccggcaag
acgctgaaggacgtgttcaacctggcgtcgacgaacggcgtgtatgcgttcaccgtgtac
gggccgaacgggttcgtgcgccgctttacgggcaacgcgcagccgcagtcgaaccaggcc
agtgcacagggcgggttcggccataaccgcaagcccgcgttgccggaagtaaagacgcat
tacgacgtgggcaacggcaacgtgtatctgaagttcacgaatcacggcgacagcatcgcg
cggttgtcggtggtcgataacgcgtatggcgcgcatccgcgtcctgtgatcgtgccgccg
aacgggtcgatcgaagaggcctgggtgctgtcggcgagccatcactggtacgacctgacg
gtgagcgacaacgatgacgcgtcgttccagcgccgcgttgccggtcacgtcgaaacgggc
aagacgagtatcagcgacccggcggctgtcgtgcccgtcatggcggcgtcgtaa

DBGET integrated database retrieval system