KEGG   Paraburkholderia caribensis: K788_0007093Help
Entry
K788_0007093      CDS       T04141                                 

Definition
(GenBank) 3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00130  Ubiquinone and other terpenoid-quinone biosynthesis
bcai00627  Aminobenzoate degradation
bcai01100  Metabolic pathways
bcai01110  Biosynthesis of secondary metabolites
bcai01120  Microbial metabolism in diverse environments
bcai01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    K788_0007093
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    K788_0007093
Enzymes [BR:bcai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     K788_0007093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ALL71735
UniProt: A0A0P0RS18
Position
unnamed:complement(2492379..2492942)
Genome map
AA seq 187 aa AA seqDB search
MPPRRMVVGISGASGVIYGVRLLQLLRKLEIETHLVMSRSAQVTLAHESDYNVADIRAMA
SVCHSNTDIGASISSGSFPVMGMIVAPCSIKTLSEIATGMTAGLLSRAADVTLKERRRLV
LMVRETPLHLGHLRSMTAVTEAGAIVYPPVPAFYANPESLTDMVDHTLGRVLDLFGLDTA
TVQRWGM
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcggcgcatggtggtcggcatcagcggcgcgtccggcgtcatttacggtgtg
cggctgctgcaactgctgcgcaagctcgagatcgaaacgcacctcgtgatgagccgctcc
gcgcaggtcacgctcgcccacgaatcggactacaacgtcgccgacatccgtgcgatggcg
agtgtctgccattcgaacacggacattggcgcgtccatttcgagcggctcgtttccggtg
atgggcatgatcgtcgcaccctgctccatcaagaccctgtcggaaatcgcgacgggcatg
acggcgggcctgctgtcgcgcgccgccgacgtcacgctgaaggagcgccgccgcctcgtg
ctgatggtgcgcgagacgccgctgcacctcggccacctgcgcagcatgacggccgtgacg
gaagcgggcgcgatcgtctatccgcccgtgcccgccttctacgcgaaccccgagtcgctg
accgacatggtcgatcacacgctcggccgcgtgctcgacctgttcggtctcgacaccgcg
acggtgcagcgctggggtatgtga

DBGET integrated database retrieval system