KEGG   Paraburkholderia caribensis: K788_0008530Help
Entry
K788_0008530      CDS       T04141                                 

Definition
(GenBank) Propionyl-CoA:succinyl-CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00020  Citrate cycle (TCA cycle)
bcai00620  Pyruvate metabolism
bcai00650  Butanoate metabolism
bcai01100  Metabolic pathways
bcai01110  Biosynthesis of secondary metabolites
bcai01120  Microbial metabolism in diverse environments
bcai01130  Biosynthesis of antibiotics
bcai01200  Carbon metabolism
Module
bcai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    K788_0008530
   00620 Pyruvate metabolism
    K788_0008530
   00650 Butanoate metabolism
    K788_0008530
Enzymes [BR:bcai01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     K788_0008530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom
Motif
Other DBs
NCBI-ProteinID: ALL67007
UniProt: A0A0P0RF26
Position
2:complement(885672..887231)
Genome map
AA seq 519 aa AA seqDB search
MHSGFRERDIGETFIMYEDRIRCAAVRGKVTSAAQAALLIDNGMRVGASGFTRAGDAKAV
PVALAERARSEGKPLRITLITGASLGHGVDSLLTDAGVLARRLPFQVDNTLRKAINRGDV
MFVDQHLSETVEMLRAGQLGKLDVAIIEAVAITETGGIVPTTSVGNSASFAILADKVIVE
INLAQPLALEGLHDIWIPGRRPHRDPLPVVRPSDRVGTTAIEIPPEKIAAIVITDKPDSP
STALPADEDTALIAAHLIEFLQNEVSHGRMPSPLPPLQAGIGTIANAVLAGFADSPFDPF
TIYSEVLQDSTFDLMDAGKVTFASGASITLTEKRQAQVFGDLARYRDRLVLRPQEVSNHP
EVIRRLGLIALNTALEFDIYGNVNSTHVGGTHMMNGIGGSGDFARNASCAIFATKSIAKD
GAISSVVPMVPHVDHNEHDVDIVVTEIGLADLRGLAPRERASLIIDKCVHPLYRDLLRDY
YRDALRFGGQTPHVLREAFAWHARFQETGSMLPERNVTV
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgcactccggctttcgcgagcgtgacatcggagagactttcatcatgtacgaagaccgg
attcgttgtgccgcggtgcgcggcaaggtcacgtcggcggcgcaggcagcgctgctgatc
gacaatggcatgcgcgtcggcgcgagcggctttacgcgcgcgggcgacgcgaaggcggtt
cccgttgcgctggccgaacgcgcgcgcagcgaaggcaaaccgctgcgtatcacgttgatc
acgggcgcctcgctgggtcatggcgtcgacagtctgttgacggatgccggcgtgctcgcg
cgccgtctgccgttccaggtcgacaacacgttgcgcaaggcgatcaatcgcggcgacgtg
atgttcgtcgaccagcatctgtcggagacggtcgaaatgctgcgcgccggccagctcggc
aagctcgacgtcgcgatcatcgaagccgtcgcgatcaccgagacaggtggcatcgtgccg
accacatcggtcggcaactcggcgagtttcgcgattctcgccgacaaggtgatcgtcgaa
atcaatctggcgcagccgctcgcactcgaaggcctgcacgacatctggattccaggccgc
cgtccgcatcgtgatccgctgcccgtcgtgcgcccgagcgatcgcgtcggcaccacggcg
atcgagatcccgcccgagaagatcgccgccatcgtcatcaccgacaagcccgacagcccg
tcgaccgccttgcccgccgacgaagacaccgcgctgatcgccgctcatctgatcgagttc
ctgcagaacgaggtctcgcacggacgcatgccttcgccgttgccgccgttgcaggctggc
atcggcacgattgcgaatgcggtgctggccggtttcgccgactcgccgttcgacccgttc
acgatctactcggaagtcctgcaggattcgaccttcgatctgatggatgccggcaaggtc
acgttcgcgtcgggcgcgtcgatcacgttgacggaaaagcgccaggcccaggtgttcggc
gatctcgcgcgctatcgcgaccggctcgtgctgcgtccgcaagaggtcagcaaccatccg
gaggtgattcgccgtttgggtctgatcgcgctgaacacggcactcgaattcgatatctac
ggcaacgtgaattcaacgcatgtcggcggcacgcacatgatgaacggtatcggcggttcg
ggcgacttcgcgcgcaacgcgtcgtgcgcgatcttcgcgacgaaatcgatcgcgaaggac
ggcgcgatttcgagcgtcgtgccgatggtgccgcacgtggaccacaacgagcatgatgtc
gatatcgtcgtgacggagatcggcctggcggacctgcgcggactcgcgccgcgtgaacgg
gcgtcgctgatcatcgacaagtgcgtgcatccgctgtaccgcgatctgctgcgcgattac
tatcgcgacgcgctgcgcttcggcgggcaaacgccgcacgtgttgcgcgaggcgtttgca
tggcatgcgcgctttcaggaaacgggctcgatgctgcccgaacgaaacgtcacagtgtga

DBGET integrated database retrieval system