KEGG   Brucella canis RM6/66: DK60_2472Help
Entry
DK60_2472         CDS       T03270                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bcar  Brucella canis RM6/66
Pathway
bcar00030  Pentose phosphate pathway
bcar00480  Glutathione metabolism
bcar01100  Metabolic pathways
bcar01110  Biosynthesis of secondary metabolites
bcar01120  Microbial metabolism in diverse environments
bcar01130  Biosynthesis of antibiotics
bcar01200  Carbon metabolism
Module
bcar_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bcar_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
bcar_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bcar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DK60_2472 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DK60_2472 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcar04147]
    DK60_2472 (zwf)
Enzymes [BR:bcar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     DK60_2472 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     DK60_2472 (zwf)
Exosome [BR:bcar04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DK60_2472 (zwf)
  Exosomal proteins of colorectal cancer cells
   DK60_2472 (zwf)
  Exosomal proteins of bladder cancer cells
   DK60_2472 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AIJ83448
Position
2:464249..465724
Genome map
AA seq 491 aa AA seqDB search
MTSQTIPVDPFDCIVFGGTGDLAERKLIPALYQRQRAGQLSDPTRIIGASRSQMTDDKYR
TFAGNAIKEHVKPEEVDQAEVEIFLKRLHYVAVDAKSDEGWDALKTLIGKKPEKIRAFYL
AVSPTLFGDIATRLKAHGLITRDTRIVVEKPIGRDLDSAKALNDTLGSVFREDQIFRIDH
YLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAEAVGLEGRAGYYDKAGALRDMVQ
NHILQLLCLVAMEPPSSIEADAVHDEKVKVLRSLQPISTHNVEELTVRGQYRAGASAGGP
VKGYLEDLESDTSNTETFVALKAEIANWRWAGVPFYLRTGKRLATRVSEIVVTFKPIPHS
IFGESAGKVIANQLVIRLQPDEGVKQWLMIKDPGPGGMRLRHMPLDMSFAESFEDRNPDA
YERLIMDVVRGNQTLFMRRDEVEAAWRWIDPILQAWEFNSQPVQGYTAGTWGPSSSIALI
ERDGRTWHESL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtcagacaattccggtagatcccttcgactgcatcgtttttggtggcaccggc
gatcttgccgagcgcaagcttattccggcgctttatcagcgccagcgcgcaggccagctt
tccgaccccacacgcatcatcggcgcctcgcgcagccagatgaccgacgacaaatatcgc
accttcgccggcaatgcgatcaaggaacatgtgaaaccggaagaggtggatcaggccgaa
gttgaaatcttcctcaagcggctgcactatgtggcggtggacgccaagtccgacgagggc
tgggatgcgctgaagaccctgatcggcaagaagccggaaaagatccgagccttttatctg
gccgtcagcccgaccctgttcggcgatatcgccacgcggctcaaggcgcatggcctcatc
acgcgcgatacgcgcatcgtcgtggaaaagccgattggccgcgatctcgattccgccaag
gcgctcaacgacacgctgggcagtgtgttccgcgaagaccagattttccgcatagaccac
tatctcggcaaggaaacggtgcagaacctgatggcgctgcgctttgccaatgcgctctac
gagccgctgtggaactccgcccatatcgaccatgtgcagatcacggtggcggaagccgtg
ggccttgaaggccgcgcaggctattacgacaaggcgggcgcgctgcgcgacatggtgcag
aaccacattctccagcttctctgccttgttgccatggaaccgccatcctcgattgaggcc
gacgccgtacacgacgagaaggtaaaggttctgcgctccctgcagccgatctccacgcat
aatgtcgaggaactgacggtccgcggacaatatcgcgcgggcgcttccgcaggcgggccg
gtcaagggctatctggaagaccttgaaagcgacaccagcaatacggaaacattcgtggcg
ctgaaggcggaaatcgccaactggcgctgggcgggtgtgccgttctatctgcgcaccggc
aagcgccttgccacgcgtgtttcggaaatcgtcgtcacgttcaagcccattccgcattcc
atctttggcgaaagcgcgggcaaggtgattgccaatcagcttgtcatccgcctgcaaccg
gacgaaggcgtgaagcaatggctgatgatcaaggatcccggtccgggtggaatgcgcctg
cgccacatgccgctcgacatgagctttgcggaatccttcgaggatcgcaacccggatgcc
tatgagcgcctcatcatggatgtggtgcgcggcaaccagaccctgttcatgcgccgcgac
gaagtggaagcggcctggcgctggatcgacccgatccttcaggcatgggagttcaacagc
cagcccgtgcagggctatacggctggcacatgggggccttcgtcctccatcgcgctcatt
gagcgcgatggccgcacctggcacgaaagcctctaa

DBGET integrated database retrieval system