KEGG   Brucella canis RM6/66: DK60_2489Help
Entry
DK60_2489         CDS       T03270                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcar  Brucella canis RM6/66
Pathway
bcar00071  Fatty acid degradation
bcar00072  Synthesis and degradation of ketone bodies
bcar00280  Valine, leucine and isoleucine degradation
bcar00310  Lysine degradation
bcar00362  Benzoate degradation
bcar00380  Tryptophan metabolism
bcar00620  Pyruvate metabolism
bcar00630  Glyoxylate and dicarboxylate metabolism
bcar00640  Propanoate metabolism
bcar00650  Butanoate metabolism
bcar00900  Terpenoid backbone biosynthesis
bcar01100  Metabolic pathways
bcar01110  Biosynthesis of secondary metabolites
bcar01120  Microbial metabolism in diverse environments
bcar01130  Biosynthesis of antibiotics
bcar01200  Carbon metabolism
bcar01212  Fatty acid metabolism
bcar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK60_2489
   00630 Glyoxylate and dicarboxylate metabolism
    DK60_2489
   00640 Propanoate metabolism
    DK60_2489
   00650 Butanoate metabolism
    DK60_2489
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK60_2489
   00072 Synthesis and degradation of ketone bodies
    DK60_2489
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK60_2489
   00310 Lysine degradation
    DK60_2489
   00380 Tryptophan metabolism
    DK60_2489
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DK60_2489
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DK60_2489
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK60_2489
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcar04147]
    DK60_2489
Enzymes [BR:bcar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DK60_2489
Exosome [BR:bcar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK60_2489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIJ83519
Position
2:complement(483584..484792)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccgtcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
aacccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system