KEGG   Brucella canis RM6/66: DK60_2556Help
Entry
DK60_2556         CDS       T03270                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K21054  D-erythritol 1-phosphate dehydrogenase [EC:1.1.1.402]
Organism
bcar  Brucella canis RM6/66
Brite
KEGG Orthology (KO) [BR:bcar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DK60_2556
Enzymes [BR:bcar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.402  D-erythritol 1-phosphate dehydrogenase
     DK60_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AIJ83860
Position
2:556752..558260
Genome map
AA seq 502 aa AA seqDB search
MAEPETCDLFVIGGGINGAGVARDAAGRGLKVVLAEKDDLAQGTSSRSGKLVHGGLRYLE
YYEFRLVREALIEREVLSNAAPHIIWPMRFVLPHSPQDRPAWLVRLGLFLYDHLGGRKKL
PGTRTLDLKRDPEGTPILDQYTKGFEYSDCWVDDARLVALNAVGAAEKGATILTRTPVVS
ARRENGGWIVETRNSDTGETRTFRARCIVNCAGPWVTDVIHNVAASTSSRNVRLVKGSHI
IVPKFWSGANAYLVQNHDKRVIFINPYEGDKALIGTTDIAYEGRAEDVAADEKEIDYLIT
AVNRYFKEKLRREDVLHSFSGVRPLFDDGKGNPSAVTRDYVFDLDETGGAPLLNVFGGKI
TTFRELAERGMHRLKHIFPQMGGDWTHDAPLPGGEIANADYETFANTLRDIYPWMPRTLV
HHYGRLYGARTKDVVAGAQNLEGLGCHFGGDFHEAEVRYLVAREWAKTAEDILYRRTKHY
LHLTEAERAAFVEWFDNANLVA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaccggaaacctgcgacctgtttgtaattggcggcggcatcaacggtgcgggc
gtggcccgcgacgcggccgggcgcggcctcaaggtggtgctggcagaaaaggacgatctg
gcgcaaggcacatcatcgcgctccggcaagctggtgcatggcggtttgcgctatctcgaa
tattatgagttccgccttgtgcgcgaagcgctgatcgagcgcgaagtgctttcgaatgcg
gcaccccatatcatctggccgatgcgcttcgtgctgccgcacagcccgcaggatcgcccg
gcctggctggtgcggcttggcctgtttctctatgaccatctgggcgggcgcaaaaaactt
cccggcacgcgtacgctcgatctgaagcgcgacccggaaggcacgccgatcctcgaccag
tacaccaagggttttgaatattccgattgctgggtggacgatgcgcgcctcgtggcgctc
aatgcggtgggtgccgccgaaaagggcgcgaccattctcacccgtacaccggtcgtctcc
gcacgccgcgaaaatggcggctggatcgtggaaaccagaaacagcgataccggcgaaacc
cgcaccttccgcgcccgctgcatcgtcaattgcgccggaccatgggtcacggacgtcatc
cacaatgtcgctgcctccacctcgtcgcgcaatgtgcgcctcgtcaagggcagccacatc
atcgttccgaaattctggtcgggcgcaaacgcctatctcgttcagaaccacgacaagcgc
gtgatcttcatcaatccatatgaaggtgacaaggcgctgatcggcaccaccgacattgcc
tatgaaggccgggcggaagacgttgcggcggatgagaaggaaatcgactatctcatcacc
gcggtaaaccgctatttcaaggaaaagctccggcgcgaagacgtgctgcactccttctcc
ggcgtgcgcccgctgtttgacgacggcaagggcaatccttccgccgtcacccgcgattac
gtgttcgatctggacgaaaccggcggtgcaccgctgctcaacgtctttggcggcaagatc
accaccttccgcgaactggcggagcgcgggatgcatcggctcaagcacattttcccgcaa
atgggcggcgactggacccacgacgcgccgctgcccggcggcgagattgccaatgccgat
tatgaaaccttcgccaataccttacgcgacatctatccatggatgccgcgcacactcgtt
catcattatggacggctctatggtgcgcgcacaaaggatgtggtggctggcgcgcagaac
ctcgaagggcttggctgtcacttcggcggcgatttccatgaggcggaagtgcgctatctg
gtggccagagaatgggcaaagacggcagaagacattctctatcgccgcaccaagcattac
ctgcatttgaccgaagccgaacgcgccgctttcgtggaatggttcgacaacgccaatcta
gttgcttga

DBGET integrated database retrieval system