KEGG   Brucella canis RM6/66: DK60_344Help
Entry
DK60_344          CDS       T03270                                 

Definition
(GenBank) hypothetical protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bcar  Brucella canis RM6/66
Pathway
bcar00051  Fructose and mannose metabolism
bcar01100  Metabolic pathways
bcar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DK60_344
Enzymes [BR:bcar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     DK60_344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C Kin17_mid
Motif
Other DBs
NCBI-ProteinID: AIJ82325
Position
1:369898..371175
Genome map
AA seq 425 aa AA seqDB search
MTKITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILDTDDEALKGHGLTFTIGRGND
ICCHAILAMRHLVVGASLDEIRAAPGKFWHHLTGDSQLRWIGPEKGAMHLATGAVVNAIW
DLLAKQAGKPVWRLVSELSPEEIADIVDYRYLTDVLTRDEAIEILRKAESGKAERIATLE
AEGYACYTTSAGWLGYDDAKLRRLCQEAIDEGFNHVKMKVGHDLEDDIRRLTIAREVIGP
DRYLMIDANQVWEVDQAIEWVRRLAFANPFFIEEPTSPDDVAGHRKIRAAIGPVKVATGE
MCQNRIMFKQFIAEGAIDVVQIDSCRMGGLNEVLAVLLMAAKYDLPVWPHAGGVGLCEYV
QHLSMIDYVAVSGTKEGRVIEYVDHLHEHFLDPCIIRNAAYMPPSLPGFSIEMKPQSIAQ
YAFKG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatcaccgatctgcgcgttttcgacctgcgctttccgacgtcgcaaagtctg
gacggctcggatgcgatgaatcccgacccggactattcggcggcctatgtcatcctcgat
acggatgatgaggcgctgaaagggcacggccttaccttcaccatcggccgcggtaacgat
atttgctgccatgcgatcctggccatgcgccatctggtcgtgggggcttcgcttgatgaa
atccgtgccgcccccggcaagttctggcatcacctgacgggtgacagccagttgcgctgg
atcggcccggagaagggcgccatgcaccttgccaccggcgctgtggtcaacgcgatctgg
gatttgcttgcgaaacaagcgggaaagccggtctggcggctggtctcggagctttcgccg
gaagaaatcgccgatatcgtggattatcgttatctgaccgatgtgctgacgcgcgatgaa
gccatcgaaattctgcggaaggctgaaagcggcaaggcagagcgtatcgccacgctggag
gcggagggctatgcctgctacacgacctctgctggctggcttggctatgacgacgcgaaa
ttgcgccggctttgccaagaagcgatcgatgaaggcttcaaccacgtcaagatgaaggtg
ggccacgatctggaagacgatatccgccgcctgaccatcgcgcgagaggttatcgggccg
gaccgttatctcatgatcgacgccaaccaggtgtgggaagtcgatcaggccattgagtgg
gtgaggcggcttgcctttgccaatccgttcttcatcgaggaaccgaccagccccgacgat
gtggccgggcatcgcaagattcgcgccgcaattggtccggtgaaggttgccaccggcgaa
atgtgccagaaccgcatcatgttcaagcagtttatcgcggaaggtgcgatcgacgtcgtg
cagatcgatagctgccgcatgggtggcctgaacgaggtgctggcagtgctgctgatggca
gcaaagtatgaccttccggtctggcctcacgcgggcggtgtgggcttgtgcgaatatgtg
cagcacctgtctatgatcgattatgtggctgtctccggcaccaaggaaggccgtgtgatc
gaatatgtcgatcacctgcacgaacatttcctcgatccctgcattatcaggaacgcggcc
tatatgccgccttcgctgcctggcttttccatcgagatgaagccgcaatccatcgcgcaa
tatgcattcaagggctga

DBGET integrated database retrieval system