KEGG   Brucella canis RM6/66: DK60_819Help
Entry
DK60_819          CDS       T03270                                 

Gene name
aspS
Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bcar  Brucella canis RM6/66
Pathway
bcar00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bcar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DK60_819 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcar01007]
    DK60_819 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcar03016]
    DK60_819 (aspS)
   03029 Mitochondrial biogenesis [BR:bcar03029]
    DK60_819 (aspS)
Enzymes [BR:bcar01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     DK60_819 (aspS)
Amino acid related enzymes [BR:bcar01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   DK60_819 (aspS)
Transfer RNA biogenesis [BR:bcar03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DK60_819 (aspS)
 Prokaryotic Type
   Other AARSs
    DK60_819 (aspS)
Mitochondrial biogenesis [BR:bcar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DK60_819 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AIJ82681
Position
1:850391..852178
Genome map
AA seq 595 aa AA seqDB search
MHRYRSHTCAALRKTDVGSNVRLSGWVHRVRDHGGILFIDLRDHYGITQIVADPDSPAFK
VAETVRGEWVIRVDGEVKARADDAVNTNLPTGEVEIFATEIEVLSPAKELPLPVFGEPDY
PEDIRLKYRFLDLRRETLHKNIMSRTKIIAAMRRRMTEIGFNEFSTPILTASSPEGARDF
LVPSRIHPGKFYALPQAPQQYKQLLMVAGFDRYFQIAPCFRDEDPRADRLPGEFYQLDLE
MSFVTQEEVWETMEPVMRGIFEEFAEGKPVTKVFRRIAYDDAIRTYGSDKPDLRNPIEMQ
AVTDHFAGSGFKVFANMIANDAKVEVWAIPAKTGGSRAFCDRMNSWAQSEGQPGLGYIFW
RKEGDKLEGAGPIAKNIGEERTEAIRKQMGLEDGDACFFVAGLPSKFYKFAGDARTRAGE
ELNLVDRDRFELAWIIDFPFYEWDEDNKKIDFAHNPFSMPQGGMDALENMDPLEIKAYQY
DLVCNGFEIASGSIRNQLPEVMVKAFEKVGLSQQDVEERFGGLYRAFQYGAPPHGGMAAG
IDRVIMLLVGAKNLREISLFPMNQQALDLLMGAPSEVSPAQLRDLHVRLAPVQKS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgttaccgcagccatacctgcgcagcccttcgcaagacggacgttggttctaat
gtccgtctgtccggctgggttcaccgcgtccgtgaccatggcggcattctcttcatcgat
cttcgcgatcattacggcattacccagattgtggccgatcctgattcgcccgcgttcaag
gttgccgaaaccgttcgcggcgagtgggtcatccgcgtcgatggtgaagtgaaggctcgc
gccgacgatgcggtcaatacgaacctgccgaccggcgaagtcgaaatcttcgcaaccgaa
atcgaagtgctttcgcctgcgaaggaactgccgctgccggttttcggcgagccggactat
ccggaagatattcgcctgaaataccgcttcctcgatttgcgccgcgaaacgctgcacaag
aacatcatgagccgcacaaagatcatcgccgcgatgcgtcgccgcatgaccgaaatcggc
ttcaatgaattctccacgccgatcctgacggcttcctcgccggaaggcgcgcgcgacttc
ctcgtgccgagccgcattcatcccggaaaattctatgcgctgccgcaggcgccgcagcag
tacaagcagcttctgatggtggccggtttcgaccgctatttccagattgcgccctgcttc
cgcgatgaagacccgcgtgccgaccgcctgccgggcgagttctatcagctcgaccttgaa
atgagcttcgtgacccaggaagaagtctgggaaaccatggaacccgtcatgcgcggcatt
tttgaagaatttgccgaaggcaagccggtgacgaaagtgttccgccgcatcgcttatgac
gacgcgatccgcacctatggttcggacaagccggacctgcgcaacccgattgagatgcag
gccgtgaccgaccatttcgccggatcgggcttcaaggtcttcgcaaacatgatcgccaac
gacgcaaaagtcgaagtctgggccattccggccaagaccggcggctccagagctttctgc
gaccgcatgaattcctgggcgcagagcgaaggccagccgggccttggctatatcttctgg
cgcaaggaaggcgacaagcttgaaggcgctggcccgatcgccaagaatatcggcgaagag
cgcaccgaagcgatccgcaagcagatgggccttgaagacggcgatgcctgcttcttcgtg
gctggcctgccgtccaagttctacaaattcgcaggcgatgcccgcacccgcgcaggcgaa
gaactgaatctcgtcgatcgcgaccgttttgaactggcttggattatcgatttcccgttc
tacgaatgggacgaggacaacaagaagatcgactttgcgcataatccgttctccatgccg
cagggtggcatggatgcgctggaaaacatggacccgctggaaattaaggcctatcagtac
gatctcgtctgcaatggttttgaaattgcctccggctcgatccgtaaccagttgccggaa
gtcatggtcaaggctttcgagaaggtgggtctcagccagcaggacgtggaagagcgtttc
ggcggcctttaccgtgccttccaatatggtgcgcctccgcatggcggcatggcggccggc
atcgaccgtgtcatcatgttgcttgtcggcgcgaagaacctgcgtgaaatctcgctcttc
ccgatgaaccagcaggcgcttgatcttctgatgggcgcgccttcggaagtttcaccggca
cagcttcgtgacctgcatgtgcgcctggcgccagtgcaaaagagctaa

DBGET integrated database retrieval system