KEGG   Brucella canis SVA13: DA85_07290Help
Entry
DA85_07290        CDS       T03305                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bcas  Brucella canis SVA13
Pathway
bcas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DA85_07290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bcas02022]
    DA85_07290
Two-component system [BR:bcas02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   DA85_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AHZ81717
Position
1:1472447..1473154
Genome map
AA seq 235 aa AA seqDB search
MAAEEEKTLSDDAPHLLVVDDDTRIRSLLSQYLTNSGFRVTMAGSAAEARRKLEGIDFDL
LILDVMMPGETGVSLTRSLREQKNVPILMLTALSETDSRIDGLAAGADDYLPKPFDPREL
TLRINNILRRGAPPAQPKIEQIVFGPYTFFIPRRELKKGTETIKLTDREQDIMAIFAERA
GETIPRHELTGQDGDVGERTIDVQINRLRRKIEQDPANPVWLQTVRGIGYKLSIE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaagaagaaaagacgctatcggacgacgcaccgcaccttctcgtcgtggac
gacgatacgcgcatccgcagccttctctcacaatatctgaccaatagcgggtttcgcgtc
acgatggctggcagtgcagccgaagcgcgccgcaagctggaaggcatcgacttcgacctt
ctgattctcgacgtgatgatgccgggagaaaccggcgtttcgctgacgcgctccttgcgc
gaacagaagaacgtgccgattctcatgctgacagccctgtcggaaaccgacagccgcatc
gacggcctggctgccggagcagacgactatctgcccaaaccctttgatccgcgcgaactg
acactgcgtatcaacaatatcctgcgccgtggcgcaccgcccgcgcagccgaagatcgaa
cagatcgtgttcggcccttatacttttttcattccgcgtcgcgaattgaagaagggaacc
gagacgatcaagctcaccgaccgcgagcaggatatcatggcgatctttgccgagcgggcg
ggcgaaaccatcccccgccatgaactgaccgggcaggacggcgatgtgggtgaacgcacg
atcgatgtgcagatcaaccgtctgcgccgaaagatcgagcaggatcccgcaaacccggtc
tggctccagaccgtgcgcggcatcggctacaaactcagcatcgaatag

DBGET integrated database retrieval system