KEGG   Brucella canis SVA13: DA85_09010Help
Entry
DA85_09010        CDS       T03305                                 

Definition
(GenBank) nitrilase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bcas  Brucella canis SVA13
Brite
KEGG Orthology (KO) [BR:bcas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DA85_09010
Enzymes [BR:bcas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DA85_09010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AHZ82012
Position
1:complement(1811565..1812419)
Genome map
AA seq 284 aa AA seqDB search
MSTFRAAAIQMRSGIDVVRNVEALEKLVADAAAQGAHYIQTPEMTGALMRDRPALFASVR
DEENDLVFRAARALAARHGVFLHIGSTAIDAGTGKIANRGGIFAPSGEKIATYDKIHMFD
VDLDNGESWRESAACEPGRQAVIAELPFAKVGMAICYDIRFPQLFQAQALAGANVITDPA
AFTRQTGEAHWHVLQRARAIENGAFLISAAQGGLHEDGRETYGHSIIVSPWGKVLAEAAH
DEPGVIVADIDLSESTAARAKVPNLKNAREFEVSLVCASQKEDA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctttcgcgctgccgcaatccagatgcgttcgggcattgatgtcgtccgcaat
gtggaggctctcgaaaaactggtcgcagatgcggcagcgcaaggcgcccattatatccag
acgccggaaatgaccggcgcgctgatgcgcgaccgtccggccctttttgcaagcgtgcgc
gatgaagagaacgacctggtcttccgggcggctcgcgcactggcggccaggcatggcgtc
ttcctgcatatcggttcgacggcaatcgatgcaggcaccggcaagatcgccaatcgcggc
gggatttttgcgccatcgggcgaaaagatcgccacttatgacaagattcatatgttcgat
gtcgatctcgacaatggcgaaagctggcgcgaatcggcggcctgtgagcccggcaggcaa
gccgtcatcgcggaactgcctttcgccaaagtgggcatggcgatctgctacgatatccgt
ttcccgcagctttttcaggcacaggcgctggctggcgcaaatgtcatcaccgaccctgct
gctttcacgcgccagactggtgaagcccattggcacgttctgcagcgcgcacgcgctatc
gagaatggcgcgttcctgatttccgcggcacagggcgggctgcatgaagatggccgtgaa
acctatggtcattcgattatcgtttcaccctggggcaaggtgctggcggaggctgcccat
gacgaacccggcgtgatcgttgccgatatcgacctgtcggaaagcacggcggcacgcgcc
aaggtgccgaacctgaagaatgcgcgggaatttgaggtgagcctcgtttgtgcgagccag
aaagaggatgcgtaa

DBGET integrated database retrieval system