KEGG   Brucella canis SVA13: DA85_10765Help
Entry
DA85_10765        CDS       T03305                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bcas  Brucella canis SVA13
Pathway
bcas00260  Glycine, serine and threonine metabolism
bcas01100  Metabolic pathways
bcas01110  Biosynthesis of secondary metabolites
bcas01120  Microbial metabolism in diverse environments
bcas01130  Biosynthesis of antibiotics
bcas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DA85_10765
Enzymes [BR:bcas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DA85_10765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHZ82338
Position
2:complement(45089..46138)
Genome map
AA seq 349 aa AA seqDB search
MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFNELFEREVAVFFVGTGT
AANSLALASVNRPGGVSLVHREAHVIEDECGAPEYFTGGARLHPIDGALGRIDPELLKRE
LKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQICRDAGLPLHMDGARFANALV
SLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDPARAKDLPFIRKRAAQLFSKTRF
VAAQFDAYLRDDLWRDLARHSNALAARLANHIHASSQMRLAWKPEANEVFAIMKQSVYDR
LRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTGFANTEEEVDRFGDMIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgcattttgcgtcagacaattgggcaggcgcccatccaaaaatcgccgagagcctttcg
ctgcatgcagccggttttgcggcagcctatggcgcaagcgagatcgacaaacgtgtggaa
caacacttcaacgaattgttcgagcgtgaagtggccgttttctttgtcggaaccggtacg
gctgccaattcgctggcgctggccagcgtcaaccggcccggcggcgtttcgctggtccac
cgcgaggcgcatgtgatcgaggatgaatgcggcgcaccggaatatttcaccggcggcgca
cgtctccacccgatcgacggcgcgctgggccgcattgatcccgaacttctgaaacgcgaa
ttgaagcgtttcaaccccgccttcgttcacgcgggccagcccatggccgtcagcatcacg
caggcgacggaagtgggtacgctttaccagccggagcatatcgccaccatttcgcaaatc
tgccgcgatgccggactgccgctacacatggatggcgcacgctttgccaatgcgctcgtg
tcgcttgatctcacacctgccgaaatgacatggaaacttggcgtggacattgtgtccttc
ggcggcaccaagaatggctgctggtgcgccgaggcgctggtcttcatggacccggcccgc
gccaaagacctgcccttcatccgcaagcgcgcagcacagcttttctccaagacgcgcttc
gttgccgcgcagttcgatgcctatctgcgtgacgatctctggcgcgaccttgcccgccat
tccaacgcgcttgctgcccgccttgccaaccatatccatgcatcaagccagatgcgcctt
gcctggaaaccggaagccaacgaggttttcgcgatcatgaagcaatcggtttatgaccgt
ctgcgcgatgcgggtgcggtattctacgactggaatcctccgcattcggaagtgggccgc
atcggcgagggcgagatttttgcccgctttgtcaccggcttcgccaatacggaagaagaa
gtggaccgtttcggcgacatgatcgcctga

DBGET integrated database retrieval system