KEGG   Brucella canis SVA13: DA85_13070Help
Entry
DA85_13070        CDS       T03305                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bcas  Brucella canis SVA13
Pathway
bcas00520  Amino sugar and nucleotide sugar metabolism
bcas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DA85_13070
Enzymes [BR:bcas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     DA85_13070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 3Beta_HSD adh_short UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AHZ82757
Position
2:522344..523357
Genome map
AA seq 337 aa AA seqDB search
MGAIFNSLTSNTIEKARRHVLVAGGAGFLGSHLCERLLNEGHSVICVDNFSTGRIENIRH
LLNFDGFSFIRHDIVNTLDLRVDEIYNLACPASPPHYQADPVHTMKTNVIGSLNLLELAA
HYKARIFQASTSEVYGDPHVHPQPENYWGNVNSFGPRSCYDEGKRSAETLFHDFHQQYGV
DIRIVRIFNTYGPRMRPDDGRVVSNFIVQALKGEDITVYGDGSQTRSFCYVDDLIEGFHR
LMYSPHAIRVPVNIGNPGEFTVGALAEQIIAMTGSRSRIVYYPLPVDDPRQRRPDITVAK
RELGWEPTVALAQGLEPTIAYFEHQLRKPTGKLVEAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcgatattcaattcactgacttcaaatacaattgaaaaagcgcgtagacatgtc
ctcgtagcagggggcgccggttttctcgggtctcatctttgcgaaagacttttaaacgaa
ggtcattcagtgatctgcgtggataatttttccacgggacgtatcgagaatatccgccat
cttttgaacttcgacgggttcagcttcatccggcacgacatcgtgaatacgctcgatctg
cgcgttgacgaaatctataatctcgcctgtccggcttcgccgccccattatcaggccgat
cccgttcatacgatgaaaaccaacgtcattggctcgctcaatcttctggagttggcggcg
cactacaaggcgcggattttccaggcctcaacttcggaagtctatggcgatccgcatgtt
catccgcagccggaaaactattggggcaatgtcaattccttcggcccgcgctcctgctat
gacgagggcaagcggtctgccgaaacgctgttccacgatttccaccagcaatatggtgtc
gatatccgcattgtcaggattttcaatacctacggtccgcgcatgcgtcccgacgacggc
cgtgtggtgtcgaacttcatcgtgcaggcgctgaagggcgaggacattaccgtctatggg
gatggttcgcagacgcgctccttctgttatgtggacgatctgatcgagggcttccaccgg
ctcatgtatagcccgcacgccattcgtgtgccggtgaatatcggcaatccgggcgaattc
acagtcggcgccctggcagagcagatcattgccatgaccgggtcgcggtcgcgcatcgtt
tattatccgctgccggtcgatgatccgcgccagcgccggcccgacatcaccgttgccaag
cgcgaactcggctgggagccgaccgtggcgctggcccagggcctggaaccgactatcgcc
tatttcgagcatcagttgagaaagccgaccggcaagctggtggaggccgcataa

DBGET integrated database retrieval system