KEGG   Brucella canis SVA13: DA85_14270Help
Entry
DA85_14270        CDS       T03305                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcas  Brucella canis SVA13
Pathway
bcas00071  Fatty acid degradation
bcas00072  Synthesis and degradation of ketone bodies
bcas00280  Valine, leucine and isoleucine degradation
bcas00310  Lysine degradation
bcas00362  Benzoate degradation
bcas00380  Tryptophan metabolism
bcas00620  Pyruvate metabolism
bcas00630  Glyoxylate and dicarboxylate metabolism
bcas00640  Propanoate metabolism
bcas00650  Butanoate metabolism
bcas00900  Terpenoid backbone biosynthesis
bcas01100  Metabolic pathways
bcas01110  Biosynthesis of secondary metabolites
bcas01120  Microbial metabolism in diverse environments
bcas01130  Biosynthesis of antibiotics
bcas01200  Carbon metabolism
bcas01212  Fatty acid metabolism
bcas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DA85_14270
   00630 Glyoxylate and dicarboxylate metabolism
    DA85_14270
   00640 Propanoate metabolism
    DA85_14270
   00650 Butanoate metabolism
    DA85_14270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DA85_14270
   00072 Synthesis and degradation of ketone bodies
    DA85_14270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DA85_14270
   00310 Lysine degradation
    DA85_14270
   00380 Tryptophan metabolism
    DA85_14270
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DA85_14270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DA85_14270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DA85_14270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcas04147]
    DA85_14270
Enzymes [BR:bcas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DA85_14270
Exosome [BR:bcas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DA85_14270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHZ82978
Position
2:complement(774367..775575)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccgtcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
aacccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system